KEGG   Kluyveromyces lactis: KLLA0B12331gHelp
Entry
KLLA0B12331g      CDS       T01025                                 

Definition
hypothetical protein
Organism
kla  Kluyveromyces lactis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(1077179..1081255)
Genome map
AA seq 1358 aa AA seqDB search
MSDEFNGLDGLSDELLSAERKLDILTQFKAHVKKTLVNEQVCVKYFENLSRLLVERGSNR
RRGNDGDDVVFALAHSALCYLIKRVAMQAQHKFQHDLIELIVSTLFSIPFADKKVWQSSV
KALEAIYLAKPNEFCQVLNESIAYNGSIRTNVLLLIDELARMESSNGRNGSMFLQKFIPF
WVQEMNTNDSISNTDIELIYDIVANRCPEPMVRSMVDSVIRESAAKVFKSRLVGKLNNHG
SESDMKDDFDRSITHTNSINSQVFNLQNELQSIMHQAPQFPTVPAPEPISYSNLSYLIKD
LESMLPAFEGSRETEQNWKIRQTNVTKLRSIVLGNVSIEFPDKFLELWKDLNLQYCVTKS
ALSLRTSLCTHGCSLVKDLCCVFNSMLDISIIENLWSCLAKLMSNTKKIANQNAFICLIT
LLSTVPFHSRLFNHCFALIRDKNNVSRLYSSTFLRILIVRFHKRLISQHHVYVEEWLQKG
LTDAQTTIRESMRITFWYWFKVSPMSGKKMLNLFQPQIKRALENSIPTHLDINYEAAIPP
QSKESSRRSSLLPKRFPSYAAPTQSSHLPRSSIKRSLTDLAQGTQSFSKRSLRTPPDHDM
NIDLTSELTNSQTNPLLNRYMKREEVEPEPLHVILSKDPKLGLDLLQKYLLSDTKIGDEE
KVQSAIVSLIRTNPKAFKPLLHLPKFYQLIPLNFSMVLLPLNDLDISMIETQFKTYDIIN
NVISILQSLEDKNSEWSIFYVRFKYQIYNFCFNTIAKMLNTVTLSDQLINELINACGKDM
DAEKYYKLILNIYLADKTKFVRLLKSTSTASTKLKIANVIQKKDSEFKIKSILNYPSVPE
PIVSPEEHHLLEMTMVNPLGKRTVSSNTVIHNSLEGLDESESNPNIIADEDNHSEKEDLV
TVPPVAKNSVNTVSFVADSPSDSDNDDTKKNGSDVVDHEEIRDHEESHGFTKFGGFSKLT
EMTKVHSVFQPETVDENVDPMEVDSPDESNLDQKSLLTDIFLKNQHQEGSVSPIFKPQEL
NNDPRHDYDSDMLSDAINGIEIKTNDGSVANRSEDDIKTLGTNMGSVSDPKTFKPINLAH
FANDSLFSFELKFIDASIGIVNLTQLKLIVQSIINNGTFKMNELQYILKCFLCYDQEVLE
WIHDQHELKDVWAITELLLSSSSSESQIPTNIAYKSIILTACLLTIDDELEHTVLKDSSI
SQLFEHIISLVAKLDTFENEIYFACTELRTLLLSQDNNKHLPSFLEKCLKALCDTKEQYI
VKISFLLETINGIISSMGNLLSVDVLRDLAKTISRYTPSDVAEWRFASCTALATIYSQLI
SRSTPVGYIRSLMPLLDPSDFEVVRSLSTTKDATRRLG
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgagtttaatgggttggacggtttgtccgatgagcttttgtcagctgagagg
aaactggatatattgacccagttcaaggctcatgtgaagaagactttggtcaatgagcaa
gtgtgtgtgaaatatttcgagaatttaagcaggttactggtggaacgaggctcaaatagg
cgacgtggtaacgatggagatgacgtagtgttcgcattagctcattcagctctgtgttat
ttgattaaacgtgttgcaatgcaagcacaacataagttccagcatgatcttatcgagcta
atcgtttcgactttgttcagtataccttttgcagataagaaagtctggcaaagttccgtg
aaggcattggaagctatatatttggcaaagcctaatgagttttgtcaggtgttgaacgaa
tcaatagcgtataatggatccatacgcacgaacgtgttgttgctaatcgatgagttggca
agaatggaatcgagcaacgggagaaacggttcgatgttcttgcaaaaatttataccattt
tgggtccaagagatgaacaccaatgattcgatatcgaatacagacatagagttgatatac
gatatcgtagccaaccgatgccccgagcctatggtacgaagtatggtcgattcagtgatt
cgagaaagtgcagcgaaagttttcaagtctcgtttggtggggaaacttaataatcatggc
tccgagagcgatatgaaagatgattttgataggtctatcacccatacaaatagcattaat
tcccaagttttcaacttacaaaatgaattacaatccattatgcatcaggcgccgcaattt
cccacggtacctgccccagagccaatctcatacagcaacttgagttatcttataaaagat
ttggagtcaatgctaccagcgtttgaaggttcaagggaaacagaacagaattggaaaatt
agacagacaaatgttaccaaacttcgatccattgtcttaggaaacgtttccattgaattc
ccggacaaatttttagaactatggaaagatctaaatttacaatactgcgtcactaaatcg
gccctttcgttaagaacttctctttgtacccacggttgcagcttggtgaaagacctttgc
tgtgttttcaattccatgttggatatctcaattatcgaaaacctttggtcatgccttgcc
aaattgatgtcaaataccaagaaaatcgccaatcaaaatgcgtttatttgtctcataacg
ttactatctactgtcccattccattcacgactattcaatcactgttttgcgttaatcaga
gataaaaataacgtatcaaggctatattcttccactttcctcagaattctaatagtaagg
ttccataagaggttgatatcgcaacatcatgtctacgtcgaggaatggttgcaaaaaggg
ttaacagacgctcagacaaccataagggagtccatgagaattacattctggtactggttc
aaagtctcaccaatgagtggcaagaaaatgctaaaccttttccaacctcagatcaaaaga
gctctagaaaatagtattcctacccatttggatatcaattatgaggcagctatccctcct
caatcaaaggaatcgtcaagaaggtcaagcttactgccaaaacgattccccagttatgct
gctccgactcaatcgtcccatttacctagatcgtcaataaaaagatcattaacggattta
gctcaagggacgcaatcgtttagcaaaagatcgttacgtacacctccggatcatgatatg
aatattgatttaacaagtgagttgacaaattcacaaacaaatccgttgttgaatcgctac
atgaagagagaagaggttgaaccagaacctcttcatgtcattttatccaaggaccctaaa
ctgggattggatttactacaaaagtatttattatcggataccaaaatcggcgatgaagag
aaggtccaatctgcaatagtgtcgttgataagaactaaccccaaagccttcaaacccctt
ttgcatttaccaaaattctaccaactgattcctttaaatttttctatggttttattgcca
ttaaatgacctcgatatctcgatgattgaaactcaattcaaaacatatgatattataaac
aatgttatttcaatattacaatcattggaggataaaaactctgaatggtctatattttat
gtgcgattcaaatatcagatatacaatttctgtttcaatactatagcaaaaatgctcaat
acggttaccctttcagatcaactgataaacgaattaattaatgcttgcggaaaagatatg
gatgccgagaaatattataagttaattttaaacatctatcttgcagataaaactaaattc
gtacgtttattgaaatcaacatcgactgcatcaactaaattgaaaatcgccaatgttatt
cagaaaaaagattcagagttcaaaataaaaagcatattgaattatccttcagtgcctgaa
cctatagtttctcctgaagaacatcatttacttgaaatgaccatggtaaatccattgggc
aaaagaactgtcagctctaatacagttatacataactcactggaaggtttagacgaaagt
gaaagtaatcctaatatcattgctgacgaagacaaccactcagagaaggaggaccttgtt
acggtgccacctgttgccaaaaattctgttaacactgtatcttttgtagcagattcgcct
tctgattcagataatgacgacactaaaaaaaacggatcagatgttgtggatcatgaagaa
attagagaccatgaagagtcacatggctttacaaagtttggaggattctcaaagttaaca
gagatgacaaaagtgcacagtgttttccagcctgaaacagtggatgaaaatgttgatcct
atggaggtcgattcacctgatgaatctaatttggatcaaaagtcattgcttacagacatt
tttttgaaaaatcaacatcaagaaggatcagtatcacctatattcaagcctcaggaatta
aataatgatccaagacatgattacgattccgacatgttaagtgatgcgataaatggcata
gaaatcaagacaaatgatgggtcggttgcaaatagatctgaagatgatattaaaactctt
ggtactaacatgggttctgtttccgaccccaaaacattcaaacctatcaaccttgctcat
tttgccaatgattcgttgttttcgtttgaattgaaatttatcgatgcttccataggcatc
gtaaatttgacgcagctgaaattgatagtccagtcgattataaacaatggcactttcaaa
atgaatgaattgcaatatatcttgaaatgtttcttatgctacgatcaagaggtcttagaa
tggatacacgatcagcacgaactgaaggatgtttgggcaataactgaattattactttca
tcaagttcatcagaatcacagattcctacaaatattgcatataaatcaatcattctcact
gcttgtctactaacgattgatgatgaacttgagcatacagtattgaaagattcaagcata
agccaactgttcgaacacattatatcgctagttgctaagctcgatactttcgagaatgaa
atatacttcgcttgcaccgaactgagaacccttttattgtctcaagacaacaacaaacat
ctaccgagcttcttggagaaatgcttgaaagcattatgcgatacaaaggagcagtacatt
gtcaaaatcagcttcttactagagacaatcaatggtatcattagttcgatgggcaattta
ctctctgtagatgtcctacgggatctcgctaaaacaatctccagatatacaccaagcgat
gttgctgagtggcgatttgcatcctgcaccgctcttgctaccatatacagccagttgata
tccagaagcaccccagtaggctatatacggtcactaatgcctctgttggacccatctgac
ttcgaagtcgtcaggtcgttatcgacgacgaaagacgcgacgcgtcgactgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system