KEGG   Kluyveromyces lactis: KLLA0B13497gHelp
Entry
KLLA0B13497g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
kla  Kluyveromyces lactis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:kla00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:1181036..1182262
Genome map
AA seq 408 aa AA seqDB search
MPPKNQSPELRRRRTTSIGRINLGDTSVPSLSTMSVTEESKHASEARLKLLSSSSEKDID
VLRKLWLSYRELSYRHSWLTSLLIISVIYLFYICSGNRTASNPLHMFVAISYQIGDTNMY
GKGPKDLCFVFFYMIFFTFLREFIMQVILRPLSIKMGSTRENKIRRMMEQMYSIFYYSIS
GPFGLYIMYHTDLWLFRTDTMYKTYPDFNNEYLYKIFYLGQAAFWTQQSCVLTLQLEKPR
KDFQELIFHHIVTLALIWLSYVFHFTKMGLSVYVTMDVSDFFLSLSKTFNYLDSSLTPPF
FLFFIVSWVYLRHYINLKILWSLLTEFTTVGNYTLNFATQQYKCWISQPIIFVLLFALHL
LNLFWLFFIARILYRLVVHGIQKDERSDSESESENEPEKESAVDEKKQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaagaatcaatcacctgaactgagacgaagacgtaccacttcaattggtaga
ataaatttaggagatacttctgtcccaagtttgtctaccatgtctgtgactgaagaaagt
aagcatgcttctgaggcaagactgaagctgttgtctagctcctctgaaaaggatattgat
gtcttgagaaaattatggttgtcttatagagagctcagttaccgtcattcatggttgacg
tcgctattgattatctccgttatttacctgttctacatttgctcgggtaacaggactgca
tccaacccattgcatatgtttgttgccatttcttatcaaattggcgacaccaatatgtat
ggtaagggtccaaaggatctatgtttcgtctttttctacatgatcttctttaccttttta
cgtgaattcatcatgcaagtcatcttacgtccattgtctatcaaaatgggtagcaccagg
gaaaataaaatcagaagaatgatggaacagatgtattcgatcttctactatagtatctct
ggaccattcggtctttacatcatgtaccatactgacctttggttgtttagaacagatacg
atgtacaagacctatccagatttcaacaacgaatatctgtacaagatattctatttgggt
caagcagcattctggacccaacaatcttgtgtgctcactttgcaactggaaaaaccaagg
aaggacttccaagaactaattttccatcatattgtcacattggctttgatctggttatct
tacgtgttccattttactaagatgggtctttctgtttatgtcactatggatgtttcggat
ttctttttatccttgtctaagacttttaactacttggactcttctttaactccgcccttc
ttccttttctttattgtttcctgggtttacttgcgtcattacatcaatttaaagattctc
tggtccttgttaactgaattcacgactgtcggtaactacacgttaaattttgcaacacaa
caatacaagtgttggatctctcaacctattattttcgtccttttgttcgcgctacatttg
ttgaacctattctggttattctttatcgccagaattttgtatcgtctagtggtacacggt
atccagaaggatgaaagaagtgacagtgaatcagagagcgaaaatgaaccagaaaaggag
tctgctgtagatgaaaagaaacaataa

DBGET integrated database retrieval system