KEGG   Kluyveromyces lactis: KLLA0B13948gHelp
Entry
KLLA0B13948g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
kla  Kluyveromyces lactis
Brite
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   KLLA0B13948g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:1222276..1229628
Genome map
AA seq 2450 aa AA seqDB search
MLRRKGESAKKRLVSGTAASLQELSLKPNSNGIQSSGKTEDTDVPGDSISGEFGAALSDS
NVENSVKAFNLIFTKLKSTSEMERTAASFELRSSLISLAREVSTEHFQRFSNDINNKVFE
LIHGNDSNEKLGGVLAVDTLIDFYSRTDELPNQTSRLANYLRVLIPSNDIEVMRAAAGTL
GKLAVPGGTLTSEFVEFEVKTCIEWLTTSPENSSSNSKQEYRKHASLLIISAIADNSPYL
LYPFVNSILDNIWRALRDTKLVIRTDASVTLGKCLTIINNRDSSLTKKWVQRLFNGCIYG
LQLNSTVSIHGTLLVYRQLVSLEGGYLKDKFEEIYETTMRYRENKNIIIRKEIYAIIPVL
AAFDPKLFTQKYLDSTMIHYLTLLKNMNSHPVTNSDKGPILISVGDIAYYVGPDIGPYLD
AIVENLRDGLTTKYKFRKDYEQEIFYCIGKLACAVRPLLAKYLNRGLLEYMLACPLSDHM
QETLLIVCEKIPSLEGTINEKLLNIICLVLSGEKFRPPGSPTPMKPFSAETARNYRDQSL
FKKTGEANNDIFDAVILTKALRMLSDIKPKYSLTEFIRRVIISYMEHDNLQVRKLAALTS
CDLFVEDSICKQTSLYALNVVSEVLSKLLTVAITDPVAEIRLEILRHLDTNFDPQLSQPD
NTKLLFMALNDEVFAIQMEAMRICGRLALVNPAYVIPSLRKTLIQLLTELKHSKLTRKKE
ECASLLCTLISSSSDVTKPYLEPVIEILLPKSQDSSSAVASTALKAIGELSVVGGEDMVP
FLDELMPLIIDTFQDQSNSFKRNAALKALGQLSASSGYVIDPLLDYPELLGVLLNILKSE
SSQNIRRETVRLIGILGALDPYKHREVERTSSTNITVEQNAPPIDVALLMQGMSPSNEEY
YPTVVIGVLMKILKDPSLSIHHSTVIQAIMHIFQTMGLRCVIFLKQIIPGFILVMHTCPP
SLLELYFQQLSVLISIVKQHIRLHVSEIVEVISEFFPIVKLQLTIISVIESLSRALEGEF
NPYLPNILSLFLDVLEKDQSNKKVVSIRILKSLVVFGPHLEEYAHLVLPTIIKLSEFSSG
NLKKAAIITIGRLSKNVNPLEMSSRIVQALVRVLNTSELEYVKATMNTLSLLLLQLNIDF
TVFIPVINKTLVKQNIQHTIYDRLVAKLLNNEPLPTKIIIDKDFDLPNKEMDDVKVASKK
LPVNQLVLKNAWDCSQQRTKEDWQEWIRRLSISLLKESSSHALRACSGLAGIYYPLAREL
FNASFASCWGELYTQYQEDLVQSLCSALSSPNNPPEIHQTLLNLVEFMEHDDKPLPISIS
TLGEYAQRCHAYAKALHYKELEFIEEPTTSTIESLISINNQLHQTDAAIGILKHAQQHHD
LQLKETWYEKLQRWDDALTAYNKREAAGEDSIEVTIGKMRSLHALGDWDQLSELAADKWA
SSKIDIKRAIAPLAAGAAWGLAQWDRIEQYIEVMKPQSPDKAFFAAVLCLHRNNFDKAQE
QIFAARDLLVTEMSALVNESYNRAYGVVVRTQMVAELEEIIQYKNLPQGSDRRAMIRKTW
NKRLLGCQKNVDVWQRILKVRSLVIKPKQDMKVWIKFANLCRKSGRLGLAQKTLNTLLEE
SSDPKNPNTARAPPPVVYAQLKYMWATGSQKEALNHLISFTSRMAHDLGLDPSNMIAQSV
PQNSSVSQHHIEDYTKLLARCFLKQGEWRVSLQPNWRLENPDAILGSYLLATHFDKSWYK
AWHNWALANFEVTSSLTQRIKDDKVLTLEDASTEFTNGAVAGLGANENFPPELVQRHVVP
AIKGFFRSIALSQSSSLQDTLRLLTLWFKFGGIPEAAQAMHEGFGLIKIDNWLEVIPQLI
SRIHQPNQTVSRSLLSLLADLGKAHPQALVYPLTVAIKSDSVSRQRAALSIIDKMRMHSP
KLVDQAELVSDELIRVAVLWHELWYEGLEDASRQFFGEHNTEKMFATLEPLHEMLKRGPE
TLREISFQNSFGRDLNDAHEWVMNYKRTKDINNLNQAWDIYYNVFRRISRKLPQLQTLDL
QHVSPKLAAAKDLELAVPGTYHAGKPVIRITHFEPIFTVISSKQRPRRLSIKGSDGKDYQ
YIVKGHEDIRQDNLVMQLFGLVNTLLQNNPESFQRHLNIQQYPAIPLSPKSGLLGWVPNS
DTFHVLIREHREASKVPLNIEHRIMLQMAPDYDNLTLLQKVEVFTYALDNTKGQDLYKVL
WLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRVTGKVVHIDFGDCFE
AAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMMVLRDNKESLMAILEAFAY
DPLINWGFDLPTQAVMEQTGIDLPLANPSELLRKGVITVEDAAKMELQQKAEVRNARATL
VLKRIADKLTGNDFPRYQELSVPDQVDKLIQQATSVENLCQHYIGWCSFW
NT seq 7353 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaagaaagggagagtccgccaagaaaaggttggtgtcaggaacagcagcctcc
ttacaagagcttagtttgaagcccaattccaatggtatacaatcatctggtaaaaccgag
gacacagatgtacctggggatagcatttccggcgaatttggtgcagcattatccgattct
aatgttgaaaatagtgttaaagcgttcaatttgatctttaccaaacttaaaagtaccagt
gagatggaacgtacagctgcctcattcgagttgagatcatcgttgatttcattggcaagg
gaagtttctacggaacattttcaacggttcagtaatgatattaataataaagtatttgaa
ttgattcacgggaacgactctaacgaaaagctaggtggtgttttagctgttgatactttg
attgatttctattctcgtactgacgaactaccaaatcaaacatcaagattggcaaactat
ttacgtgttctaataccatccaatgatattgaagtaatgagagcagcagcaggaacctta
ggtaaactagcagttcccggtggaacattgacatcggaatttgtggaattcgaagttaaa
acatgcattgagtggttgaccacatctccagaaaactcctcatcgaattcaaaacaagaa
tataggaaacatgcatctttattaattatcagtgcaattgctgataattctccatatcta
ctatatccatttgtgaattcaatcttggataacatttggagagcgttgagagatacaaaa
cttgtaattagaacagatgcatctgtcacattgggaaaatgtttgactatcattaataac
cgtgattcctctctgacgaagaaatgggttcaaagactatttaatggatgcatatatgga
ttacaactcaatagtactgtttccatacatggtacattgttggtttatagacagttggta
tcattggaaggtggatatttgaaggacaaattcgaagagatatatgagactactatgaga
tacagagaaaacaaaaacattataattagaaaggaaatctacgctatcattccggtactt
gctgcgtttgatcctaagctatttacacaaaaatatttggattcaacaatgatccattac
ttgactttactaaagaatatgaactcgcatccggttacaaattctgacaagggtcctatc
ttaatttctgttggtgatattgcatattacgttggtccagatattggaccatatcttgac
gccattgtcgaaaacctacgggatggcctaacgacaaaatacaaattcagaaaggattat
gaacaggaaattttctattgcatcggcaaactcgcatgcgcagttcgtccattattagca
aaatatctaaacagaggactacttgaatatatgttagcatgccctttaagtgatcacatg
caagagaccttactgattgtatgcgagaaaatcccttcgttggagggaacaatcaatgaa
aagctactcaatataatatgtcttgtactatctggtgagaagttcagaccaccgggatcc
cctacccctatgaaaccattctccgcagagaccgcaagaaattatagagatcaatcactc
ttcaagaaaactggtgaagccaataacgatatttttgatgctgttatacttacgaaggct
ttaaggatgctttccgacataaaacccaaatattctctcacagagttcattaggcgtgtc
atcatatcatatatggaacatgacaatttgcaagtgaggaagcttgcagctttgacgtca
tgcgatctattcgtagaggactccatctgtaagcaaacttcactttacgctttgaatgtt
gtttccgaggtattgagcaaactattgactgtagcaattacagatccagttgccgagatt
agacttgagatcttgagacacttagatactaattttgaccctcaattatcacaaccagat
aacactaaactactatttatggccctgaacgacgaagtctttgcaatccaaatggaagca
atgaggatatgtggtcggttagccctcgtgaatcctgcatatgtcattccatctttgagg
aaaactcttattcagttattgactgaattgaaacactcaaagctaactagaaagaaagaa
gagtgtgcttctctattatgtacattgatcagctccagtagtgatgttacaaagccatat
ctagagcctgtaattgaaatactactaccgaagtcacaagactcttcctctgcggtggca
tcaacagctcttaaagcaatcggtgagctatcggtggtcggaggtgaagatatggttcct
ttcttggatgaattgatgccattaataattgatactttccaagatcagtctaactcattc
aaaagaaatgcagctttgaaagcattaggccaattatctgcctcttcgggatatgttatt
gatccgctattagattatcctgaattacttggcgttcttctcaatattttaaaatctgaa
agttcacagaacattcgtagagaaaccgtcaggctgataggtattcttggtgctttagat
ccgtataaacacagagaagtggaacgtacatctagtacaaatattacggtagaacaaaat
gcccctccaattgatgtggctttgttaatgcaaggtatgtctccatctaacgaggagtat
tatcctaccgtagtaattggagtcctcatgaagattttgaaagatccttcgttatctatt
caccattcaactgttattcaagcgatcatgcacattttccagacaatggggcttcgctgt
gtcatatttttgaaacagatcattcctggatttatactggttatgcacacatgtccacct
tcacttcttgagctctacttccaacagctcagtgttttgatttcaattgtgaaacaacac
atcagactacatgtgtctgaaattgtggaagtaatctcagaattcttccctatcgtaaag
ctacaattaactatcatctcggttatcgaatcactatcaagagccttagaaggagaattc
aatccttatttacctaatatactatctttgtttttggatgttttggaaaaagaccagtcg
aataagaaggttgtctcaattagaatattgaagtcattggtagtttttggaccacatcta
gaggaatatgctcacctcgtactgccaactatcataaaactatcggagtttagctcagga
aatttgaagaaggccgcaatcattactataggacgtctatcgaaaaatgtcaatccacta
gaaatgtcgtctaggattgtgcaagccctagtaagagtcttaaatacatcagaactcgag
tacgtgaaagcaacaatgaacacattaagtttacttcttttacaactcaatattgatttt
actgtattcattccagttatcaataaaactttagtcaaacagaacattcagcacacaata
tacgaccgtttggttgccaaacttttgaataatgagccactaccgaccaaaattattatt
gataaagatttcgatttacctaataaagaaatggacgatgtaaaggtagcttccaagaag
cttcctgtcaaccaacttgtgctaaaaaatgcctgggattgtagtcaacaaagaacaaag
gaggactggcaagagtggattagacggctatcaatttctttactcaaagaatcatcttct
catgctttacgtgcctgctccggattggctggtatctactatccattagctagagaatta
ttcaacgcctcatttgcaagttgttggggtgaactttacacgcaatatcaagaggatttg
gttcagtctttgtgctctgctttatcctcaccaaacaatcctcctgaaatccaccagaca
ttattaaatttggttgaattcatggagcatgacgacaaaccgctaccaatttctatatca
actcttggcgaatacgctcagcgttgtcatgcatatgcaaaagctttacattataaagaa
ctggagttcattgaagagccaacaacttcaactatcgagtccttaatcagtatcaataat
caattacaccaaacagatgcagcaatcggtattttgaagcatgcgcagcaacaccacgat
ctacaattgaaggaaacttggtacgaaaagttacaaagatgggatgacgctttgactgcg
tataataagcgtgaggctgctggtgaagattcgatagaagttacaattggtaaaatgaga
tcattacacgccttaggtgactgggatcaattgtctgaacttgcagcagacaagtgggct
tcgtcaaagatagacattaagagagcaatcgctcctctggctgcgggtgctgcgtggggt
ttagctcaatgggatcgaatcgagcagtacattgaggtgatgaaaccacaatctccagat
aaggccttctttgctgccgttctttgtctacatcgcaacaatttcgataaagcacaagaa
caaatctttgctgccagagatcttcttgttactgaaatgtctgccttggtgaacgaaagt
tacaaccgtgcttatggtgttgtggtaagaactcaaatggtcgcggaattagaagaaata
attcagtataaaaatttaccacagggttccgatagacgggctatgatacggaagacatgg
aacaaaagattgttaggttgtcaaaagaatgttgatgtctggcaaagaattctaaaggta
cggtcactagttataaagcctaaacaagatatgaaagtatggattaaatttgctaatctt
tgtaggaagtccggacggttaggtctagctcagaagacattgaacactcttctggaagag
agtagtgatccaaagaatccaaatactgctcgtgcacctccaccagttgtctacgcccaa
ttgaaatacatgtgggctacaggttctcaaaaggaagcactcaaccatttaataagcttt
acttctcgtatggcacacgatctaggcctcgatcccagtaacatgatagctcaaagtgtc
ccacagaatagcagcgtatctcagcatcacattgaagactatacgaagttacttgctcgt
tgtttcttaaagcaaggtgaatggagagtctcactacagccaaattggcgcctggaaaat
cctgatgctatcctaggttcctatttactagctactcactttgataagtcgtggtataaa
gcttggcataattgggcattggcaaacttcgaggtcacttcgtcgcttacccagcgaatc
aaagatgacaaagttctaacacttgaagacgcctctacggagtttaccaatggtgccgtg
gcagggcttggcgcgaatgaaaatttccctccagaactggtccaacgtcatgtcgtgcca
gccatcaaaggttttttccgttctattgctctttcccaatcgagttctttacaggatacg
ttaagattactcactttgtggttcaaattcggtggtattccagaagctgcacaagctatg
catgaaggctttggattgatcaagatcgataactggttagaagttatcccacaattgatc
tcccgaattcatcaaccaaatcaaaccgttagtagatctttactatctttgctagctgat
ttgggtaaagcccatccacaggcattagtgtatccattgacagttgccattaaatctgat
tcggtctcaagacagagggcagctttgtccatcatagataagatgagaatgcacagtcct
aaacttgtcgatcaagcagaattagtaagtgacgaattgatcagagtcgctgttttgtgg
cacgaactttggtacgaaggtcttgaagatgctagtagacaattctttggtgaacataac
acggaaaagatgtttgccactttggagccattgcatgagatgctaaaacgtggtcctgaa
accttgcgtgagatttcgttccaaaattcgtttggtagggatttgaacgatgcccacgag
tgggtaatgaactacaagagaacaaaagatatcaacaaccttaaccaagcttgggatatc
tattataatgtcttccgtcgtattagcaggaaactccctcaattacagacgttggatctc
caacatgtttcaccaaaactagctgctgcgaaagatttagaacttgctgttccaggtaca
tatcatgccggaaaacctgtcattagaattacccatttcgagccaatatttactgttatt
tcatccaaacagcgtcctcgtaggctatctatcaagggtagcgatggtaaagactatcaa
tatattgtcaagggccatgaagatatcagacaagataatttggtcatgcaattgtttggt
ttggttaatactttattacagaataaccccgagagtttccaaaggcatttgaacattcaa
caataccctgctatcccattatcacctaaatccggtcttttgggatgggttccaaatagt
gatacattccatgtcttgatcagagaacatcgtgaagcaagcaaagttccactaaatata
gaacacagaataatgctccaaatggctcctgattatgataacctaactctattgcaaaaa
gtggaagttttcacttatgctcttgataacaccaagggccaggacttgtataaggttcta
tggttaaagagtcgttcatcagaatcatggctcgaacgtcgtacaacttacacaagatcg
ttagccgtcatgtcaatggtaggatatattttaggtttaggtgatcgtcatccaagtaat
ttgatgttggaccgtgttactggtaaagttgtccacattgatttcggtgactgtttcgaa
gctgcaattctcagagagaaatacccagaaaaggtaccattcagattaacaagaatgtta
acgtacgcaatggaagtcagtggtattgaaggtagtttccgtatcacctgtgagaacgta
atgatggtcctaagggataataaggagtccttgatggctattttggaagcctttgcatac
gatccattaatcaactggggtttcgatctaccgactcaagccgtgatggaacagacggga
atagatctacctcttgcaaatccaagtgagttactaagaaagggcgtcatcaccgttgaa
gatgcggccaagatggaactacaacaaaaggcagaagtccgcaacgcaagagccactctt
gttctcaaaagaatcgctgataaacttactggtaacgatttcccaaggtatcaagaacta
tctgtgcctgatcaagtcgacaagttgatccagcaagctacatcagtagaaaacctatgt
caacattacatcggctggtgttcgttctggtga

DBGET integrated database retrieval system