KEGG   Kluyveromyces lactis: KLLA0B14366gHelp
Entry
KLLA0B14366g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
kla  Kluyveromyces lactis
Pathway
kla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01230  Biosynthesis of amino acids
Module
kla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KLLA0B14366g
Enzymes [BR:kla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KLLA0B14366g
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     KLLA0B14366g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS GATase Peptidase_C26 QRPTase_C
Motif
Other DBs
NCBI-GeneID: 2897007
NCBI-ProteinID: XP_452170
UniProt: Q6CV69
Position
B:1260726..1262198
Genome map
AA seq 490 aa AA seqDB search
MSAKRVVLIDNYDSFTWNIYEYLCTEGAEVLVFRNDKITVEEVEALNPDIVMISPGPGHP
ETDSGISRDCIAFFCGKVPVFGVCMGQQCMFDVFGGEVSFAGEIVHGKTSPIFHDGKGFF
RKVPQGVAVTRYHSLAGAKETLPDVLEVSARTETGIIMGVRHKKYTVEGVQFHPESILTE
SGHQMIKNILEVSGGTWDENAANLARNELGKTASTDKAKSILETIYEKRREDVQLQSTIP
GYRFSDLEANYKLGLAPRVQDFYARLTATEKTAVLAEVKRASPSKGDIDLSVVASEQALK
YGQAGASAISVLTEPHWFKGSIEDLRNVRKVLEVAFANDESKRPCVLRKEFIFSKYQILE
ARLAGADTVLLIVKMLDDNLLKELYDYAKSLDLEPLVEVNSAEELKRALAIGSRVIGVNN
RDLHSFNVDLSTTSKLVSSVPEGTLLIALSGITIAADADQYKKEGVHGVLVGEALMRAES
VNKFIEELIN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctaaaagagttgttttgatcgataactacgattcgttcacctggaacatctat
gaatatctttgcactgagggtgctgaagttttagttttcagaaatgataagattactgtg
gaagaagttgaagcattgaaccctgatattgtcatgatttcaccgggtccaggtcatcca
gagaccgattccgggatatcaagagactgtatcgcattcttctgcggcaaagtccctgtg
tttggtgtctgcatgggtcagcaatgtatgtttgatgtctttggcggtgaagttagcttt
gctggagaaattgttcatggtaagacttcaccaatattccatgatggaaaaggtttcttt
agaaaagtacctcaaggtgtcgcagtgacgcggtaccattcgcttgctggcgccaaggaa
acacttcctgatgtgcttgaagttagtgcaagaacggagactggaattattatgggtgtg
agacataagaaatacactgtggaaggtgtgcaattccatccagaatctatcttgaccgag
agtgggcatcaaatgatcaagaatattcttgaagtatcaggaggtacttgggatgagaac
gcagctaacttggctaggaatgagctcggaaagacagccagcactgataaagcgaaatct
atcttggaaactatttacgaaaaacgccgtgaagacgttcaactgcaatcgacgatccca
ggttatcggttctctgatttagaagccaactataagttaggtttagctccaagggtacaa
gatttctatgcaagattaactgctactgagaaaacagcagtcttggctgaagtgaagaga
gcttctccatcgaagggtgacattgatttgagtgtcgttgcttcagagcaagcgttgaag
tatggtcaggcaggtgcttcagcgatctctgtattgaccgaacctcactggttcaaaggt
tccattgaagatttgagaaatgtaagaaaagtgttggaggtggcatttgccaatgacgaa
tcgaaaagaccatgtgtattacgcaaagaattcattttctcaaagtaccaaatcctagaa
gctagacttgcaggcgctgatactgtgctattgatcgtgaagatgcttgacgacaacttg
ttgaaggaactgtacgattatgcaaaaagtttggatttagaacctctagtggaagtaaac
tccgcagaagaactaaaacgtgcgttggcaattggatcaagagtgatcggagttaataac
agagacttgcactctttcaacgtagatttgagtactacctcaaaattggtcagttctgta
ccagagggaaccctactaattgctttatctggaataacaatagcagctgatgctgatcaa
tataaaaaggaaggtgttcatggtgttcttgttggagaagctctcatgagagctgaatct
gtaaataaattcatcgaggagctaatcaactaa

DBGET integrated database retrieval system