KEGG   Kluyveromyces lactis: KLLA0B14883gHelp
Entry
KLLA0B14883g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
kla  Kluyveromyces lactis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KLLA0B14883g
  Lipid metabolism
   00600 Sphingolipid metabolism
    KLLA0B14883g
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KLLA0B14883g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KLLA0B14883g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
B:1310501..1313578
Genome map
AA seq 1025 aa AA seqDB search
MSCLIPENLRNPKKVHENRLPTRAYYYDQDIFESLNGPWAFALFDAPLDAPDAKNLDWET
AKKWSTISVPSHWELQEDWKYGKPIYTNVQYPIPIDIPNPPTVNPTGVYARTFELDSKSI
ESFEHRLRFEGVDNCYELYVNGQYVGFNKGSRNGAEFDIQKYVSEGENLVVVKVFKWSDS
TYIEDQDQWWLSGIYRDVSLLKLPKKAHIEDVRVTTTFVDSQYQDAELSVKVDVQGSSYD
HINFTLYEPEDGSKVYDASSLLNEENGNTTFSTKEFISFSTKKNEETAFKINVKAPEHWT
AENPTLYKYQLDLIGSDGSVIQSIKHHVGFRQVELKDGNITVNGKDILFRGVNRHDHHPR
FGRAVPLDFVVRDLILMKKFNINAVRNSHYPNHPKVYDLFDKLGFWVIDEADLETHGVQE
PFNRHTNLEAEYPDTKNKLYDVNAHYLSDNPEYEVAYLDRASQLVLRDVNHPSIIIWSLG
NEACYGRNHKAMYKLIKQLDPTRLVHYEGDLNALSADIFSFMYPTFEIMERWRKNHTDEN
GKFEKPLILCEYGHAMGNGPGSLKEYQELFYKEKFYQGGFIWEWANHGIEFEDVSTADGK
LHKAYAYGGDFKEEVHDGVFIMDGLCNSEHNPTPGLVEYKKVIEPVHIKIAHGSVTITNK
HDFITTDHLLFIDKDTGKTIDVPSLKPEESVTIPSDTTYVVAVLKDDAGVLKAGHEIAWG
QAELPLKVPDFVTETAEKAAKINDGKRYVSVESSGLHFILDKLLGKIESLKVKGKEISSK
FEGSSITFWRPPTNNDEPRDFKNWKKYNIDLMKQNIHGVSVEKGSNGSLAVVTVNSRISP
VVFYYGFETVQKYTIFANKINLNTSMKLTGEYQPPDFPRVGYEFWLGDSYESFEWLGRGP
GESYPDKKESQRFGLYDSKDVEEFVYDYPQENGNHTDTHFLNIKFEGAGKLSIFQKEKPF
NFKISDEYGVDEAAHACDVKRYGRHYLRLDHAIHGVGSEACGPAVLDQYRLKAQDFNFEF
DLAFE
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgccttattcctgagaatttaaggaaccccaaaaaggttcacgaaaatagattg
cctactagggcttactactatgatcaggatattttcgaatctctcaatgggccttgggct
tttgcgttgtttgatgcacctcttgacgctccggatgctaagaatttagactgggaaacg
gcaaagaaatggagcaccatttctgtgccatcccattgggaacttcaggaagactggaag
tacggtaaaccaatttacacgaacgtacagtaccctatcccaatcgacatcccaaatcct
cccactgtaaatcctactggtgtttatgctagaacttttgaattagattcgaaatcgatt
gagtcgttcgagcacagattgagatttgagggtgtggacaattgttacgagctttatgtt
aatggtcaatatgtgggtttcaataaggggtcccgtaacggggctgaatttgatatccaa
aagtacgtttctgagggcgaaaacttagtggtcgtcaaggttttcaagtggtccgattcc
acttatatcgaggaccaagatcaatggtggctctctggtatttacagagacgtttcttta
ctaaaattgcctaagaaggcccatattgaagacgttagggtcactacaacttttgtggac
tctcagtatcaggatgcagagctttctgtgaaagttgatgtccagggttcttcttatgat
cacatcaatttcacactttacgaacctgaagatggatctaaagtttacgatgcaagctct
ttgttgaacgaggagaatgggaacacgactttttcaactaaagaatttatttccttctcc
accaaaaagaacgaagaaacagctttcaagatcaacgtcaaggccccagaacattggacc
gcagaaaatcctactttgtacaagtaccagttggatttaattggatctgatggcagtgtg
attcaatctattaagcaccatgttggtttcagacaagtggagttgaaggacggtaacatt
actgttaatggcaaagacattctctttagaggtgtcaacagacatgatcaccatccaagg
ttcggtagagctgtgccattagattttgttgttagggacttgattctaatgaagaagttt
aacatcaatgctgttcgtaactcgcattatccaaaccatcctaaggtgtatgacctcttc
gataagctgggcttctgggtcattgacgaggcagatcttgaaactcatggtgttcaagag
ccatttaatcgtcatacgaacttggaggctgaatatccagatactaaaaataaactctac
gatgttaatgcccattacttatcagataatccagagtacgaggtcgcgtacttagacaga
gcttcccaacttgtcctaagagatgtcaatcatccttcgattattatctggtccttgggt
aacgaagcttgttatggcagaaaccacaaagccatgtacaagttaattaaacaattggat
cctaccagacttgtgcattatgagggtgacttgaacgctttgagtgcagatatctttagt
ttcatgtacccaacatttgaaattatggaaaggtggaggaagaaccacactgatgaaaat
ggtaagtttgaaaagcctttgatcttgtgtgagtacggccatgcaatgggtaacggtcct
ggctctttgaaagaatatcaagagttgttctacaaggagaagttttaccaaggtggcttt
atctgggaatgggcaaatcacggtattgaattcgaagatgttagtactgcagatggtaag
ttgcataaagcttatgcttatggtggtgactttaaggaagaggttcatgacggagtgttc
atcatggatggtttgtgtaacagtgagcataatcctactccgggccttgtagagtataag
aaggttattgaacccgttcatattaaaattgcgcacggatctgtaacaatcacaaataag
cacgacttcattacgacagaccacttattgtttatcgacaaggacacgggaaagacaatc
gacgttccatctttaaagccagaagaatctgttactattccttctgatacaacttatgtt
gttgccgtgttgaaagatgatgctggtgttctaaaggcaggtcatgaaattgcctggggc
caagctgaacttccattgaaggtacccgattttgttacagagacagcagaaaaagctgcg
aagatcaacgacggtaaacgttatgtctcagttgaatccagtggattgcattttatcttg
gacaaattgttgggtaaaattgaaagcctaaaggtcaagggtaaggaaatttccagcaag
tttgagggttcttcaatcactttctggagacctccaacgaataatgatgaacctagggac
tttaagaactggaagaagtacaatattgatttaatgaagcaaaacatccatggagtgagt
gtcgaaaaaggttctaatggttctctagctgtagtcacggttaactctcgtatatcccca
gttgtattttactatgggtttgagactgttcagaagtacacgatctttgctaacaaaata
aacttgaacacttctatgaagcttactggcgaatatcagcctcctgatttcccaagagtt
gggtacgaattctggctaggagatagttatgaatcatttgaatggttaggtcgcgggccc
ggcgaatcatatccggataagaaggaatctcaaagattcggtctttacgattccaaagat
gtagaggaattcgtatatgactatcctcaagaaaatggaaatcatacagatacccacttt
ttgaacatcaaatttgaaggtgcaggaaaactatcgatcttccaaaaggagaagccattt
aacttcaagatttcagacgaatacggggttgatgaagctgcccacgcttgtgacgttaaa
agatacggcagacactatctaaggttggaccatgcaatccatggtgttggtagcgaagca
tgcggacctgctgttctggaccagtacagattgaaagctcaagatttcaactttgagttt
gatctcgcttttgaataa

DBGET integrated database retrieval system