KEGG   Kluyveromyces lactis: KLLA0C01111gHelp
Entry
KLLA0C01111g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
kla  Kluyveromyces lactis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLLA0C01111g
Enzymes [BR:kla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLLA0C01111g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KLLA0C01111g
  Exosomal proteins of colorectal cancer cells
   KLLA0C01111g
  Exosomal proteins of bladder cancer cells
   KLLA0C01111g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(83710..85293)
Genome map
AA seq 527 aa AA seqDB search
MLFKNTVRFGLAALMAASCSAQGDAVAPEDSAVVKLDADTFHEFIKEHPLVLAEFFAPWC
GHCKTLAPEYVKAADELESKDIPLAQIDCQENQQFCQEQGIPGYPSLKLFKNGNPEAAGE
YQGGRDAKAIVNYMLKQSEPAVQVVEDEKAFNEIIAKNLDNTYVVDGSVPEFNETFYQVA
DSLRDDYSFIQHGSDGKLSIYLPGESEPIVYEGEDFDAETISTWIAVEAFPYFGDVNGET
YQAYMAVKVPLAYFFYTSPEEREEYESHFVDLAKKFRGKVNFAGLDASKFGRHAENLNQK
QQFPLFAIHDTIKDLKYGLPQLADEEFAALEKPITLATEEITKFVEDFLEGKAEPIVKSE
EIPEIQENSVFKIVGKNHEEIVRDPKKDVLVEYYAPWCGHCKKLAPTYESMAEFAHENDE
LKDKVLIAKIDATANDVQSVEIPGFPVLYLWPAGEETEPILFEGPRTAEAFLAFIKENGS
HGVDGLALYEEYLVEVEKKKQEEEEAQKAKEVEEVAEEDSELEQDEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcaagaataccgttagatttggtttggctgctttgatggcagctagttgttct
gctcaaggagatgctgttgctccagaggattctgctgttgttaagttagatgctgataca
ttccatgaatttatcaaggagcatccattagttttggccgaattctttgctccatggtgt
ggtcactgtaagactttggcaccagaatatgtgaaagcagcagatgaattggaatctaaa
gatattccattggctcaaattgattgtcaagaaaatcaacaattctgtcaagagcaagga
atcccaggttacccatctttgaaattattcaagaacggtaacccagaggctgctggtgaa
taccaaggtggtagagacgctaaggctattgtcaactacatgttgaagcaatctgaacct
gctgtgcaagttgtagaagatgaaaaggctttcaatgaaattattgccaagaacttggat
aacacctatgttgtcgacggtagcgttccagaattcaatgaaactttctaccaagtcgct
gattctttaagagatgactacagtttcattcaacacggtagtgatggaaagttgtccatt
tacttgccaggtgaatctgagccaattgtgtacgaaggtgaagactttgacgccgaaact
atttccacttggattgctgttgaagcattcccatactttggtgatgttaacggtgaaact
taccaagcttatatggctgtcaaggtgcctttggcatacttcttctacacttccccagaa
gaacgtgaagaatacgaatctcactttgttgacttggctaagaaattcagaggtaaggtc
aactttgctggtttggatgcttccaaattcggtagacacgccgagaacttgaaccaaaag
cagcaattcccattgtttgccatccatgacaccattaaggacttgaagtacggtttgcca
caattggctgatgaagaattcgcggctttggaaaaaccaatcactttagccactgaagaa
atcaccaagtttgttgaagatttcttggaaggtaaggcggaacctattgttaaaagtgaa
gaaattccagaaatccaagaaaactctgtctttaagattgttggtaaaaaccatgaagaa
attgtccgtgatccaaagaaggatgttttagttgagtactacgctccatggtgtggtcat
tgtaagaagttggcaccaacttatgaaagcatggctgaatttgctcatgaaaatgacgaa
ttgaaagataaggtcttgattgccaagatcgatgctactgccaatgacgttcaatctgtc
gaaatcccaggtttcccagtcttatacttgtggccagccggtgaagaaactgaaccaatt
cttttcgagggaccaagaactgccgaagctttcctagccttcatcaaggaaaacggttct
cacggtgttgatggccttgccctttacgaagaatacttagttgaagtggagaagaagaaa
caagaagaagaagaagcacaaaaggcgaaggaagttgaagaagtggctgaagaagattct
gaactagagcaagatgaattgtaa

DBGET integrated database retrieval system