KEGG   Kluyveromyces lactis: KLLA0C01111gHelp
Entry
KLLA0C01111g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLLA0C01111g
Enzymes [BR:kla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLLA0C01111g
Chaperones and folding catalysts [BR:kla03110]
 Protein folding catalysts
  Protein disulfide isomerase
   KLLA0C01111g
Membrane trafficking [BR:kla04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    KLLA0C01111g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KLLA0C01111g
  Exosomal proteins of colorectal cancer cells
   KLLA0C01111g
  Exosomal proteins of bladder cancer cells
   KLLA0C01111g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 AhpC-TSA Thioredoxin_7 Thioredoxin_2 ERp29_N cNMP_binding
Motif
Other DBs
NCBI-GeneID: 2892548
NCBI-ProteinID: XP_452244
UniProt: F2Z6F2 Q9URT0
Position
C:complement(83710..85293)
Genome map
AA seq 527 aa AA seqDB search
MLFKNTVRFGLAALMAASCSAQGDAVAPEDSAVVKLDADTFHEFIKEHPLVLAEFFAPWC
GHCKTLAPEYVKAADELESKDIPLAQIDCQENQQFCQEQGIPGYPSLKLFKNGNPEAAGE
YQGGRDAKAIVNYMLKQSEPAVQVVEDEKAFNEIIAKNLDNTYVVDGSVPEFNETFYQVA
DSLRDDYSFIQHGSDGKLSIYLPGESEPIVYEGEDFDAETISTWIAVEAFPYFGDVNGET
YQAYMAVKVPLAYFFYTSPEEREEYESHFVDLAKKFRGKVNFAGLDASKFGRHAENLNQK
QQFPLFAIHDTIKDLKYGLPQLADEEFAALEKPITLATEEITKFVEDFLEGKAEPIVKSE
EIPEIQENSVFKIVGKNHEEIVRDPKKDVLVEYYAPWCGHCKKLAPTYESMAEFAHENDE
LKDKVLIAKIDATANDVQSVEIPGFPVLYLWPAGEETEPILFEGPRTAEAFLAFIKENGS
HGVDGLALYEEYLVEVEKKKQEEEEAQKAKEVEEVAEEDSELEQDEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcaagaataccgttagatttggtttggctgctttgatggcagctagttgttct
gctcaaggagatgctgttgctccagaggattctgctgttgttaagttagatgctgataca
ttccatgaatttatcaaggagcatccattagttttggccgaattctttgctccatggtgt
ggtcactgtaagactttggcaccagaatatgtgaaagcagcagatgaattggaatctaaa
gatattccattggctcaaattgattgtcaagaaaatcaacaattctgtcaagagcaagga
atcccaggttacccatctttgaaattattcaagaacggtaacccagaggctgctggtgaa
taccaaggtggtagagacgctaaggctattgtcaactacatgttgaagcaatctgaacct
gctgtgcaagttgtagaagatgaaaaggctttcaatgaaattattgccaagaacttggat
aacacctatgttgtcgacggtagcgttccagaattcaatgaaactttctaccaagtcgct
gattctttaagagatgactacagtttcattcaacacggtagtgatggaaagttgtccatt
tacttgccaggtgaatctgagccaattgtgtacgaaggtgaagactttgacgccgaaact
atttccacttggattgctgttgaagcattcccatactttggtgatgttaacggtgaaact
taccaagcttatatggctgtcaaggtgcctttggcatacttcttctacacttccccagaa
gaacgtgaagaatacgaatctcactttgttgacttggctaagaaattcagaggtaaggtc
aactttgctggtttggatgcttccaaattcggtagacacgccgagaacttgaaccaaaag
cagcaattcccattgtttgccatccatgacaccattaaggacttgaagtacggtttgcca
caattggctgatgaagaattcgcggctttggaaaaaccaatcactttagccactgaagaa
atcaccaagtttgttgaagatttcttggaaggtaaggcggaacctattgttaaaagtgaa
gaaattccagaaatccaagaaaactctgtctttaagattgttggtaaaaaccatgaagaa
attgtccgtgatccaaagaaggatgttttagttgagtactacgctccatggtgtggtcat
tgtaagaagttggcaccaacttatgaaagcatggctgaatttgctcatgaaaatgacgaa
ttgaaagataaggtcttgattgccaagatcgatgctactgccaatgacgttcaatctgtc
gaaatcccaggtttcccagtcttatacttgtggccagccggtgaagaaactgaaccaatt
cttttcgagggaccaagaactgccgaagctttcctagccttcatcaaggaaaacggttct
cacggtgttgatggccttgccctttacgaagaatacttagttgaagtggagaagaagaaa
caagaagaagaagaagcacaaaaggcgaaggaagttgaagaagtggctgaagaagattct
gaactagagcaagatgaattgtaa

DBGET integrated database retrieval system