KEGG   Kluyveromyces lactis: KLLA0C02783gHelp
Entry
KLLA0C02783g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
kla  Kluyveromyces lactis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:250633..253029
Genome map
AA seq 798 aa AA seqDB search
MTKSVVPAGRRWVSHDQVHVKSLDVKAVVGPDSWDQLKPQNLKVTLHMQTDFKKSSITDD
LKYSLNYAVVSRDISNHVQKNIKRNYKDVNTFGRNIVEYAKKSYPGINALTVEVESKEAN
IRSNSIKSTTSDSHDELDHIIISDFKILTLIGVFTFERLKRQYVDFTIKLPIAEGSDVPQ
YDKIINQVTEYVENSNFKTVEALVETAAQVVLTNNGYFFDRPSLPIEVKVMKLNAITETE
GVGVSCERCYDDFKSVAPISLPVAKSKVINSCTGGDFDLPVQNIKLDKDSWKSAILAFGS
NIGDRFKNVVEAVSLLKAHKDVEVVCSSSLFESEPMYFKDQQPFLNGCIKIKTRLLPDAL
LELCKKIEYDELNRVKHFDNGPRTIDLDIVTYYDSNGADFSMNTPELTIPHPRMLERSFV
LEPLCELISPCCVHPITAEPIHNHLKQLYENDNPEDVLWKLVPVGDKFLKFKIQWEKDIL
TGLRRPVSSSSAYLMGVVNVTPDSFSDGAQDYDNKEVVVSKIEAMVSAALELHEIVILDI
GGCSTRPGSLQASEEEELARILPIINAVTTSKSIPLDKVVISIDTYRSVVAEAAISAGVG
IINDISGGVFDPRILQVVSKHPNVAYVLSHIRGTIDSMSSETSYLTSDENVKEYISGKEG
NEIDNLFIKTIGREVCSRYQDTFRNNIFRWQLFLDPGIGFAKVGKQNLELIKGIPLLRNY
SCIIGNEYYSLINLPVLVGPSRKKFIGDITKTPSAKDRDFATGAIVSACVANGCDIIRVH
DVANISKALKLLNELYRN
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagtgttgtaccagctggtcgaaggtgggtttcgcacgatcaagtgcatgta
aagagcctcgatgttaaagctgttgttggtccagattcttgggatcagctgaaaccgcag
aatttgaaagtgacattgcatatgcagaccgacttcaagaaatcgtcgattacggatgat
ttgaaatactctttaaactatgcagttgtctccagagatatatccaatcatgttcaaaaa
aacattaaacgcaattacaaagatgtgaacacttttggaaggaatattgtggaatatgcc
aagaaatcataccctggcatcaatgcgttgaccgtagaagtggaatctaaggaagcaaac
atcagatctaatagtatcaaaagtactaccagtgattcccatgatgagttggatcacatt
ataatctcggacttcaagatattgacacttattggcgtctttacttttgaacgtttgaaa
aggcaatacgtagattttaccattaaattgcctattgccgaaggctctgatgttccacaa
tatgacaaaattattaaccaggttacagaatacgtagaaaactctaatttcaagaccgtg
gaagccttagttgaaactgctgctcaggttgttttgacaaacaacggctatttctttgat
agaccctcacttccaatcgaagttaaggttatgaaattaaatgccattaccgaaacagaa
ggggtgggtgtttcttgcgaacgatgttatgatgacttcaagtccgtagcgccaatatcc
cttccagtggccaaatccaaagtcataaattcatgcactggtggtgattttgatctccct
gtccagaacattaaattagataaggactcttggaaatctgcaatattagcttttggatcc
aatattggtgatagattcaaaaatgtcgtagaagccgtgagcctgttgaaagctcataaa
gatgtagaagtggtgtgctcttcatcattgtttgaaagtgaaccaatgtacttcaaagat
caacagcctttcctaaatggatgtatcaaaatcaagacaaggcttttacctgacgcatta
ctcgaattgtgtaaaaaaattgaatatgatgaactaaacagagttaaacattttgataac
ggaccacgtactattgacttagatatcgtaacatattacgactcgaatggtgctgatttt
tcaatgaatacgccagaactaactattcctcatcccagaatgcttgaacgaagctttgtt
ttagagcctttatgcgaattgatcagcccttgttgtgtacatccgataactgcggaacct
attcacaatcacttgaagcagctttacgagaacgataatcctgaagatgtactctggaaa
ttggtgcctgtgggtgataaattcttgaaatttaaaattcaatgggaaaaggatatctta
accggtttaagacgtcctgtgtctagtagttcagcgtacttgatgggggttgtcaatgta
acaccagattctttttctgatggagctcaagattatgacaataaagaagtagtcgtatcg
aagattgaagcaatggtttctgcagcactcgaattacatgaaatagtaattcttgatatt
ggaggttgttcaacaagaccgggctccttgcaggcctctgaagaggaagaactagcaaga
attcttcccatcattaatgcagtcaccacatcaaaatcaattcctttggataaagtcgtt
atatctattgatacttatcgttctgttgtcgcagaagcagcaatttccgcgggtgtgggt
ataatcaatgatatatcaggtggggtttttgatccaagaattttacaagtggtgagcaag
catcctaatgttgcttatgttctttcccatatcagaggcactatcgattcgatgtcgtcc
gaaacctcttatttgacttcagacgaaaacgttaaggagtacatttccggcaaggaagga
aatgagatcgacaatctatttattaaaacaatcggcagagaagtatgttcgagatatcaa
gacacttttaggaataacattttccgttggcaattgtttttggatcctggaattggattt
gccaaagttggtaagcaaaatctcgagttaataaaaggtattcctctactacggaactat
tcttgtatcattggtaatgagtactattctttaataaatcttcctgtgttggttggacca
tctagaaagaagttcattggagatataacaaagactcctagtgccaaagatagagatttc
gcaacaggagcgatagtgtccgcttgcgtagcaaacggatgcgacataatcagggtacat
gatgttgctaatattagcaaggcattgaaactcttaaatgaactttatagaaactag

DBGET integrated database retrieval system