KEGG   Kluyveromyces lactis: KLLA0C03476gHelp
Entry
KLLA0C03476g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:314815..318573
Genome map
AA seq 1252 aa AA seqDB search
MTSEKRINKSDSECLKYSLHGTPSEGINLEQLISGSNADGIISTSSIEENPTDLPSSESS
IPSILYDAIPPIQDQRSIVANMWVRFNNEKKEGDLVFIIPERWLALFQDPNIIDYRSIPS
IDVASISLDYKNFILQDYTQHLYTAVPASMFTLLQQWYDLTPNSKPISTFIVRDANNQLL
VEYDRPRCRIHHLVAGNGNANIYPGSSRHSIDHKIPLMFTMSRLATMKDVIQRCLEVFYA
KEPHLDKSSLTHRIWYINERVADPKSTQTLLSNYVLSPSAFLELQTKHEITKSMYSRQLK
DYDSQIISLVVEVKQKSSNQHWPSNFFHYNKLNAPSGIMGLSNLGNTCYMNSALQCLLHI
PELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLYSLFAPSYGQSTFYAPRNFKNTIG
HYNSLFAGYGQQDSQEFLAFLLDGLHEDLNRVIEKPYVNKPEFPNDGQIDDTDQIVLLAA
NMWDYIKKRNDSVIMDLFVGLYKSTLVCPNCNHVSITFDPYNDLTLPLPIENYWSTKVTI
FPQNSPPCTLEVELSKTSSYNDLKAYVAQHANMHANDLIGAEIFNHQFYNNYESNVEADY
LPISELISESDTVIFYEVHRGQDDLVVPILNTRFEEGFKTPRLFGYPFFIALSQAEQFSY
GAIRKKIEKCYQNFSGGFSEFPIVGKTKMPDLSSMPLLEKRYSQCEIESIMPELEYINPE
MSVDEFFQLKILKVDSVSSNRRVTSFSGVSLGQTSDEPNSQIWIPPTASLITYNHSELIR
KALPEAIEAAYYYSDMLSNEDDIPNDQTVSDTANDLATKSYTSPNPEENVTSSAEALDGT
LHLKVSPLLDVHNAIICEWEAVKVINVFDEDNGVNWDHPAILENLSLSEVRKTRAQTEKS
SITLDSCLRLFSQPEILGSADSWYCPNCKQHTQASKQIELWNTPDILLIHLKRFENQRSF
SDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLIAVDNHYGGLGGGHYTAYCRNFIDGK
WYYFDDSRVNEVSPENSIAGSAYLLFYRRRTSGNQTLGNGKLRDIIDISRKEYEQKQDEF
MTNVETLYAATHTDTESEASDSDRSSVDEEMDSDNSDCENDKKSAFVDQSDISSNSLGMD
NLTYSNRPSKDNTIHTSKNANGSIESTLNNNELPEAEQTVTATERKGALQYNVSSLEVGS
NIAKLDTHDSSRRKLRLLDKIYLPDSSNLNSSTDSLSPCISHTESSSNNNES
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgagaagaggataaataaatcggactcagaatgtctgaaatattcattgcac
ggcactccttccgaaggcattaacttggaacaattgatatccggttccaatgcggacgga
attatatcgacttcatcgattgaggaaaatccgacagaccttccgtcgtccgaatcatcg
attccaagtattctgtatgatgcaatccctccaattcaagatcaacggtcaatagtggct
aatatgtgggtacgttttaataatgaaaagaaggaaggtgatttggtattcattattcca
gagcgttggcttgccctttttcaggatcctaatattattgactacagatccattccttca
attgatgttgcatcaatttcactcgattataaaaattttatattacaagactacacacaa
catctatatacagcagtaccagcatcaatgttcactttacttcaacaatggtatgatttg
acccctaattcgaaacctatttccacattcattgtaagagacgcaaacaaccagttgctt
gtcgaatatgacaggccaaggtgcagaatacatcatttggtagctggaaatggtaatgca
aatatttatcccggatccagcagacatagcattgaccataaaatccccttaatgttcaca
atgtctaggttggcaacaatgaaagatgttatccaaaggtgcttagaagttttctatgct
aaagaaccacatcttgacaaaagctcccttacccatagaatatggtacataaatgagcgc
gttgcagaccctaaatctacacaaactttactgagtaactatgtgttatccccttctgca
tttttggagcttcagactaaacacgaaattactaaatcgatgtattcacggcaactcaag
gattatgattcccaaataatcagtttggttgttgaagttaaacagaaatcttcaaaccaa
cattggccctccaattttttccattacaacaaattgaatgcaccatcgggaattatgggg
ttgtcaaatttgggaaacacttgttacatgaattccgcattacaatgtctattgcacata
ccggaactcaatgaatactttctttacaaaggctatgaacgtgaaattaatatcaacaat
cccttaggacacaaaggtgacgttgcccatgcatttggacatctgttgtattcactcttt
gcaccttcgtacggtcaatctacgttttatgctcccagaaatttcaagaatacgatcggt
cactataattccctttttgccggttatggtcaacaggattctcaagaatttctagcattt
ttattagatggtctacacgaagatctcaatagagtgatcgaaaagccatacgtgaacaaa
ccagaattcccaaatgatggtcaaatagatgatacagatcaaatagtgctgttggcagcc
aatatgtgggattacattaaaaaacggaatgattcagtcattatggaccttttcgtcggt
ttatacaaatcaacacttgtttgccctaattgcaaccatgtatcaatcacattcgatcca
tataacgacttgacattacctcttcccattgagaattattggtcgacaaaggttacgatt
tttcctcaaaactctcctccttgcaccttagaagttgaactatctaaaacatcttcttac
aatgacctcaaagcatatgttgctcaacatgcaaatatgcatgcgaatgacttaataggc
gcagagatatttaatcatcaattctacaacaactatgaatcgaacgtcgaagctgactat
ttgccaatatccgagttaatatcagaaagtgatactgttatattttacgaggttcataga
ggacaagatgatcttgttgttccgatccttaacacacgttttgaagaaggttttaaaaca
ccgaggttgtttggatatcctttctttattgcactctcgcaagccgaacaattcagttat
ggtgcgatacgaaagaaaatcgaaaaatgttatcaaaacttctccggaggattttctgag
ttccccatagtaggtaagactaagatgccagatctctcctccatgcctttattggagaaa
aggtacagtcaatgtgagatagagtcaattatgcctgaattagaatatatcaatccggag
atgtcagtcgatgagttttttcaactgaaaatcttgaaggttgattctgtcagttcgaat
cgtagagttactagtttttctggtgtttcactaggacagacttccgatgagcctaactca
caaatatggataccgcctacagcatccttgataacctataatcacagcgaactgatacgc
aaagctctcccagaggctattgaagcagcatattactattctgatatgttatcaaacgaa
gatgatattcctaatgatcaaacagtttcggatactgctaatgaccttgccacaaagtcc
tacaccagtcccaaccccgaagaaaatgtgacaagtagtgcagaggccctggatggaaca
ttgcacttaaaagtcagtccattgttagatgtccacaatgcgattatttgcgaatgggag
gctgtcaaagtgattaatgtttttgatgaagataatggagtgaactgggatcatccagca
attcttgaaaatttgagcttgtcagaagtcagaaaaacaagagcccaaacagaaaaatca
agtattactctcgattcgtgtttacggctcttttctcaacccgaaattttgggctcagca
gactcttggtactgtccgaattgcaaacagcatacccaggcttctaaacagatagaatta
tggaatactcctgatattttattgatacatttaaagcgtttcgaaaatcagcgatctttt
agtgataagatcgacgcgactgttaaatttccaatagaaggtttggatatgtctccttat
ttatcttacaaaaaggaaggtgaaaatgatgtttatgatttgattgctgtggacaaccat
tatggtggtcttggaggtggccattacaccgcatactgcagaaactttattgacggcaaa
tggtactattttgacgattcccgggttaatgaagtatctcctgaaaatagcattgccgga
tctgcttacttgttattctacagaagacgcacttcagggaaccaaactcttggcaatgga
aaattgcgggacattattgatatttctcggaaagaatatgaacagaaacaggacgagttt
atgacaaacgtggaaacattatacgctgcaacacatacagacactgagagtgaagcatca
gattcggacaggagctcagttgatgaagaaatggactctgacaacagcgactgtgaaaat
gataaaaaatcagcatttgttgatcagagcgatatttcaagcaattctttaggtatggac
aacttaacatacagtaacagaccttcaaaagataacactattcatacttcgaagaatgca
aatggtagcatcgaatctactttgaacaacaatgaactacctgaagcagaacaaacggtt
acagcaacagaaagaaaaggagctctacaatacaacgtatcgagcctcgaggttggcagt
aatattgcgaaattagatacgcatgactcttcgcggagaaagcttaggcttttagataaa
atatatcttccagattcctctaaccttaactcgagtacagattcactatcaccatgtatt
tcccacacagaatcatcttctaataataacgaatcttag

DBGET integrated database retrieval system