KEGG   Kluyveromyces lactis: KLLA0C03498gHelp
Entry
KLLA0C03498g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kla  Kluyveromyces lactis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KLLA0C03498g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KLLA0C03498g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(318733..319734)
Genome map
AA seq 333 aa AA seqDB search
MGIVVVGSLNFDLVTYTERVPVAGETFVADSFETHAGGKGLNQCISLAKLTKPSDDQTSN
IRMVGHVGSDSFGNQLLSKLQYHNINTEYVEEVDDESTGVAVIIVEKAKGQNRIMITAGA
NSKTMYSDKQLEVMFQNNAKEFIVFQHEIPDPPSIMNWIKANRPNFEVVFNPSPFHALKV
EDWKSVDILIVNEIEAIQIGESLYGEAVVENYKSRIAESFKLGYLELAQYYQSNLINTSN
SSVVIITLGEFGAVFTSKQNVKGGHVPSIAVEKVVDTTAAGDTFLGAVVSQLYQKRDLEK
AIQFATVASSITITRKGAAETIPLYDEVINKIE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggcatagttgtcgtgggatcgttaaattttgatttggtcacgtatacggagcgtgtt
ccggtagcaggagagaccttcgttgcggattcgtttgaaacacatgctggtggtaagggg
ttgaatcaatgcatttcgctcgcgaaattaaccaaaccatctgatgaccagacaagcaac
attaggatggttggccacgtaggttctgattcatttggaaatcaactactatcaaaattg
cagtatcataacatcaatacagaatatgttgaagaggttgatgacgagtcaactggtgtt
gcagtaattatagtggaaaaagctaagggacaaaatagaatcatgattacagcaggagcg
aacagtaagactatgtattctgataagcagcttgaagtgatgtttcaaaataacgccaaa
gaattcattgtgtttcaacatgaaattcctgatcctccttccatcatgaattggataaag
gcaaatagaccaaactttgaggtagtattcaacccttctccatttcatgcattaaaagta
gaagactggaaatctgttgatattttaattgttaatgaaattgaagccattcaaattggc
gaatcactgtatggtgaagccgtggttgagaactacaaatcgagaattgcggagagcttc
aagctgggatacctagaattagcgcagtattatcagagtaatttgataaacacatcaaat
tcctcggttgttattataactttgggagaattcggtgcagtttttacctctaagcaaaac
gttaaaggaggtcacgttccttcaatagcggttgagaaagttgttgatactactgcggct
ggtgataccttccttggagcggtagtatctcaattatatcaaaaacgcgatctagagaaa
gctatacagtttgcaactgtagctagttccataaccattacgagaaaaggtgcagcggaa
acaattccgctatacgatgaggttattaataaaatagagtga

DBGET integrated database retrieval system