KEGG   Kluyveromyces lactis: KLLA0C03828gHelp
Entry
KLLA0C03828g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
kla  Kluyveromyces lactis
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    KLLA0C03828g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     KLLA0C03828g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: Other group
  TTK family
   KLLA0C03828g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:349187..351568
Genome map
AA seq 793 aa AA seqDB search
MLGSDGVVRLNQSSFPTAESQHEYSRYQDAKTGLEEPTHSNPLHFVRHFNGRNTTHTSNH
TEDQSQSTVFTMVNKQFQPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTHS
HTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSESR
VDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKD
PSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATS
GTLALKREFTQYRRTQTARQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDRELANKR
EALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPK
STVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGK
GGSGKVYKVKSSDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMG
QGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPAN
FVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKV
GKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVID
TIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEEL
SEDVWNKLAEFKL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcttggatctgatggagttgtacgacttaaccagtcgtcatttcctacagcagaaagc
caacatgagtatagtcgatatcaagatgctaaaacaggattagaagaacctactcactcg
aaccctttgcattttgttaggcatttcaatggacggaacactacacatacctcgaatcac
acagaagatcaatctcaatcaacagttttcacaatggtgaataaacaattccaaccaagc
atgacaacaatgaataccgtggtcaaagaagataatgatatttcgaattcaaatagcaac
catgacaacaaatataataaactgaacgaggagtcactgatgaaagacgacactcacagt
catacttctcaaaagttcaaagtactgcaacagagtatgaaagaggagctatataacagt
acaaccaaatcatcaaacaaacgaaatagaaggtttatcacttcccgactgtcctcacta
ggacctgccaaacgtaacctttctacaagtttcaatgtggattcccctagtgaatccagg
gttgataatagtcaaatcaacagtagcataataaatgatacatctaacatttcccagcaa
gatattgaaaattcgcatacctctaatagttctaatacaggttacaggtaccatgaccat
aacatttttctagagactcacagacaacattcaacacccagccacgatgagaacaaggac
ccttccgccaatctgcaacctaacatcaactatgagaatatagattttggtgatctcaac
ccataccagtacctaaagaagtataatcttcccagtggtgagcttccgtacatctcgaaa
gtatattttgaaaggcaaaaggaagagaatagaaaaaccgtgttgagaaaggccacctct
ggaacgctggcgttaaagagggaattcactcaatataggagaactcaaacagctcggcaa
ccacggagaaaacacaactttggcacagataaaacgtcgttacaggatccgctttcttct
ccattgcagaaaaatcagctggtattccaggaggtagatcgtgaactagctaacaaacgc
gaagcgctgaaaccattagatgtcaataatccatctagcagtcaagaagctaagcgacca
aagtacgaaaatgatcatgtacccgaggattatcgacctccttttttctcccataggaag
gcaccatcgccacatgattcgaaaccctttaaaaaggtcgagatagtggaacctccgaaa
tccactgttgaagttattcctttgaagtccgagggttgcgatgtttcatcaaaactgaac
aagggggataattatctgaactataatggctcctttgatacaaagaagagaacctcgtat
gctgttccaacgatcacagtgaacggtaccgcatatgaaaaggtggaactactcggcaaa
ggtggatcgggtaaagtttacaaagtgaaatcttctgatcacaaggtatacgcgttgaaa
cgcgtgtctttcgatgaatttgatgagtccagtattgatggcttcaaaggggaaatagag
cttctaaagaaactagaaaacaagcagcgagttgttaagttaattgactatcatatggga
caaggtgtcttatttctcctaatggaatgtggtgaacatgatctatcccaagtattgact
cagagatccaaaataccatttgatacggaatttgtcagatatcactttcaagaaatgata
aaatgtgtgaaggtggttcacgatgctgatattgtccattctgatttgaaacccgcaaat
tttgttttcgtcaagggaatgttaaagataattgattttgggattgcgaatgcggttccc
gatcacactgtaaatatttatcgagacaaccagatcggaactcccaattatatggctccc
gagactttggttgcaatgaacttcacaaggaatgatggtgaacaagccaaatggaaagtg
ggtaaaccatcagatgtttggtcctgtggatgtatcctctaccaaatggtgtacggaaaa
ccgccttatggtacgttccagggaaacaataggttatatgcgatcatgaatcctgatgtt
aagattccttatcctgaaaaagactctttcggtacagtgataccaagaactgttattgac
actataagatcatgtttggaaagaaatcccatatctcgtgttacaattgaccagctatta
agtggtgcattaattaatcctgtcaccgtaacaaaattcttcatacatgatttgataaaa
aatgcagtaaactatggttgcgatcaaaaacatgtcaataatgagcgtgtggaagaatta
tctgaagatgtttggaacaaactagctgaatttaaattatag

DBGET integrated database retrieval system