KEGG   Kluyveromyces lactis: KLLA0C04081gHelp
Entry
KLLA0C04081g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kla  Kluyveromyces lactis
Pathway
kla00010  Glycolysis / Gluconeogenesis
kla00260  Glycine, serine and threonine metabolism
kla00680  Methane metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
kla01230  Biosynthesis of amino acids
Module
kla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kla_M00002  Glycolysis, core module involving three-carbon compounds
kla_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0C04081g
  Energy metabolism
   00680 Methane metabolism
    KLLA0C04081g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLLA0C04081g
Enzymes [BR:kla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KLLA0C04081g
Membrane trafficking [BR:kla04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KLLA0C04081g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KLLA0C04081g
  Exosomal proteins of melanoma cells
   KLLA0C04081g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 2891825
NCBI-ProteinID: XP_452379
UniProt: Q6CUL0
Position
C:371620..372480
Genome map
AA seq 286 aa AA seqDB search
MRLYVLRHGQSEVNQRNIFGGWVDVHLTEKGLDQARNSAILIKAYCQSQGLELPKLGYTS
RLIRTEETMNEILKEFGKQPEFRIVSGELPPQQTSDNGKFPVYQSWRLNERHYGSWQGQS
KHKMLEEYGEEQYMYIRRDYLGKPPKADLNREMVQDFDQGDTGYEFKEPNRHVKYLEEEI
THDELPNGESLCDVVQRLKPLLENMILPNLKERGDSLIVGHGSTVRSLLKILEGISDTDI
KEVNIPNAIPSVIELDDNFRFIRKFYLDPESAKVNAELVRQEGFKE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagattgtatgttttaaggcacggccaaagtgaagtaaaccaaagaaacatatttggg
ggatgggtagatgttcatctgactgaaaagggtctagatcaggccaggaatagcgccatt
cttattaaagcatactgtcaatcgcaaggtttggagctacccaagcttggttatacttcc
agattgatcagaacagaagagaccatgaatgagattctcaaagagtttggcaaacagcct
gaatttcgtatcgtcagcggtgagctaccaccgcaacagacatcagataatggtaaattc
ccagtttatcagagctggagattgaatgaaagacactacggttcatggcagggtcaaagt
aaacataaaatgttggaagagtatggtgaagaacagtatatgtatatcagaagagattac
ctcggaaaacctccaaaagcagatttaaacagggagatggtacaagatttcgaccaaggt
gatacaggatatgaatttaaagaaccaaacaggcatgttaaatatttggaggaagagatt
actcatgatgaattgcccaatggtgagtctttgtgcgatgtcgttcaaagattgaaacca
ttgcttgaaaatatgattcttccgaacttgaaggaacgtggtgacagccttatagtcggt
catggaagcacagtccgttcactcttaaagattttagaaggcattagcgatactgacatt
aaggaagtcaatattcctaatgccattccttcagtcattgaactagatgataatttcaga
tttattagaaaattctacttagacccagaaagtgccaaagtcaatgcagaattagttcgc
caggaaggattcaaggaataa

DBGET integrated database retrieval system