KEGG   Kluyveromyces lactis: KLLA0C04906gHelp
Entry
KLLA0C04906g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00521  
ferric-chelate reductase [EC:1.16.1.7]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.7  ferric-chelate reductase (NADH)
     KLLA0C04906g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(445437..447611)
Genome map
AA seq 724 aa AA seqDB search
MQINLLVFLVWCLSLADTASAVPFNLFKPTRWHTNWVHLSSSACLKDVKDHQWAFELETL
ASTHGSFLLQRRSLRAACLYEPAMETWVSCARDMLRKKGKYPKSEDDIKLLDVIAERVNS
ACEQNWGGKNPISPLTGGDILVKIENATSHIQPFPKSEKTTLYAPINGLESKLNYLLMAY
YGPVHNLDFSTIGGFILCGYWILVLCIAAIYKLLLRYPRSRDWMKSKFFTIVDGRIVIPA
LLHNHSTPIGWPFYFGMIPTRLETLAILGYTILHTVLLSVRYFYDVYYLVGDPRVQKVLF
ITDRAGIYAFAQLPVLFLFGGRNQILEMMTGVKFRSFVTYHKWIGRFMFWDSMIHSIGYT
YHAFMEDYWKYAKNSATFQSGRFAMWYIGGIILFSFFFFRNHYYEFFLLSHILLVSLVLV
FLWKHCAQIGWNEFLAVTIVFWVLDRLFRLFKIFRFGSQRATLQLFHDKYIRLSIPITAN
NWHAKPGQYCYIHFITPTLFWQAHPFSVMDSLVHGNNLVIVLAVKEGITRRLSEYIPYNG
KVEMRVAVEGPYGEPLEGGLWNNALLIAGGTGVPSSLAFIVKTLEHDVDLRQTSIKLIWS
LRDLSILDCYIQELRVLKANDVDLQIHYTGEQELRSIKSMHENSEEDYEGLQLLSSDIPY
YGQIIRRRPDIPELFEEFLEITDELLVVTCGSGPFVDKVREISARKTLEHPHKLINYIED
LQVW
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaacctgttggtgtttttggtctggtgtctgtctctagctgatactgcttca
gctgtgccctttaatctattcaagcctaccagatggcatactaactgggtacatctttcc
tcttctgcatgcttgaaggatgtaaaagatcatcaatgggcgttcgaactcgagactctt
gcttcgactcacggatctttccttttgcaacgtcggagtttgagagccgcatgcctatac
gaacctgcaatggaaacctgggtatcatgcgcacgtgacatgctaaggaagaaaggtaag
tatccaaaatcagaagacgatattaagctcctggatgttatagctgaaagggtcaattca
gcttgtgagcaaaattggggtggtaaaaatccaatatcacctctaactggtggagatatc
ttggtaaagattgaaaacgcgacgtcgcatatacaaccatttcctaaaagtgaaaagaca
actctatatgctccaatcaacggtttagaatccaaactcaattatttattgatggcctat
tatgggccagtgcataatcttgatttcagtaccattggtgggttcattctatgtggttat
tggattttggtcttatgtattgctgccatctacaaattattacttcggtaccctcgctca
agagattggatgaaatcaaaattcttcaccattgttgatggccgtatcgttatacctgct
ttattgcataaccattccacccctattggatggccattctattttggtatgatcccgact
agattggagacgttagccattttggggtatactattttgcatactgtgcttttgtcagtc
agatacttttacgatgtatattatctagtcggtgatcctcgtgttcaaaaagttttattt
atcactgatcgtgcgggtatctatgcattcgctcaattgcccgtattgtttttgtttggt
ggaaggaatcaaatccttgagatgatgactggtgttaagtttagatcttttgtcacatac
cataagtggattggcagatttatgttctgggactccatgattcattcgatcggttacact
taccatgcatttatggaagactactggaaatatgctaaaaacagcgccactttccaatct
gggaggttcgcaatgtggtacattggtggtattatccttttctcgttctttttcttcaga
aatcattattacgaattcttcctactcagtcacattctacttgtatctttggtcttggta
tttttatggaaacattgtgctcaaatcggttggaacgaattccttgcagtcaccatcgtg
ttttgggttctggatagactattcagattgttcaaaattttcagatttgggtcacaacgt
gcaactttgcaattgttccatgataagtacatcagattatcaatccccatcaccgcgaac
aactggcatgccaaaccaggtcaatattgttacatccactttattactccaacccttttc
tggcaagcgcatccattttctgtcatggattccttagtacatggcaacaatcttgtcatt
gtattagcggtaaaagaaggtattactagaaggttaagtgagtatattccttacaacggc
aaagtagaaatgcgtgttgccgttgaaggtccatatggcgaaccgcttgaaggtggatta
tggaataacgctttgttaatagccggcggtactggtgtaccatcctcccttgcatttatt
gtcaaaacattagaacatgatgttgatttaagacaaacttccatcaaactaatttggtcc
ttaagagatctatcaattttggactgctatattcaggaactaagagtcctcaaagcaaat
gatgtcgacttacagatccattacaccggtgaacaagaactacgctctataaagtctatg
cacgaaaactcggaagaagactacgagggtcttcaattgttaagctcggatattccttat
tatggccaaataatccgaagaagaccagatattccagaactatttgaagaattcctagag
atcactgacgagctactagtagtgacatgcggctcgggtccattcgtagataaggtcaga
gaaatttctgccaggaaaactctcgaacatcctcacaagttgatcaactatattgaagat
ctgcaggtctggtga

DBGET integrated database retrieval system