KEGG   Kluyveromyces lactis: KLLA0C05940gHelp
Entry
KLLA0C05940g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
kla  Kluyveromyces lactis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLLA0C05940g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KLLA0C05940g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:524768..526690
Genome map
AA seq 640 aa AA seqDB search
MWFLNSVNLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWL
KVRHESTVPALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGM
ISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSI
WDISNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEG
GVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHT
FTDVRYAGTNVTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLL
HGFLTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLL
QTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLN
TRPTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAV
TMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVDATTPISSTTSS
SASSTSTSDSGNKENSARILAPRSTLSLLIGGLASVFISF
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttttgaactcagttaatctgttgtttctggtatgttcggttgccctacatcta
gatgccgttaacgcatggtctccgacaaatggttacgctcctggtgtggtcgattgtgat
gagaatataaacttggttagaaaagctgatgctgtttcagatgatgaagcggattggttg
aaagttagacacgaatctactgtaccagctttgaaggacttcttgcagcgtggttttaag
ggttttaccaatgacacctcaatcattgataaactgttagcgacccaagacactgctccc
aaggttgctattgcctgctctggtggtggttatagagcaatgttgagcggtgctggtatg
atttctgccatggataatagaactgacggtgcaaatgatcatggtttgggtgggttatta
caaagttcaacttatttggctggtttgtctggtggtaactggctcgttgggactttggcc
tacaataactggacttctgttcaagcaattatcaacaacatgactgacgataatagtatt
tgggatattagtaattctatcgtcaatcctggcggtatcaacattttttccagtatttct
cgttgggatgacatctcagacgcagtggaagagaaaaaaaaagccggcttcaacacatct
ataactgatgtatggggccgcgccctatcttacaatttcttcccatcattggacgaaggt
ggtgtgggttatacgtggaataccttgagagatgttgatgtttttaaaaatggtgaaatg
cctttccctatttcagtagctgttggtagatatcccggtactcaggttgtcaatttgaat
gcaactgtctttgaatttaatccatttgaaatgggctcctgggattacaccttacatact
ttcaccgatgttagatatgctggtaccaatgttactaatggtactccaaacgtaacagga
aaatgtgttgcaggcttcgataatacaggttttgttatgggtacgtcctcctccttgttt
aaccaatttttattacaacttaacactactgatttgccatctttcttgtacaacttactt
cacggattcttgactgatgcttctgatgattacgatgacatctcgatttgggcaccaaac
ccgttctacgaaatcacgaacataccttctaattattcccaatccatcagtgaagatgat
acattgtatttagtggatggtggtgaagatgggcaaaatatcccattgacaccattgctg
caaactgagcgggaaatcgatgttatctttgctttggataacagtgcagacacggatcaa
tcttggcctgacggattttcattgactcagacttacgctcgtcaatttggtctgcaaggg
aaaggcattgccttcccttatgttccagatgtgaacactttcaccaatcttggattaaat
acaagacctaccttctttgggtgcgatgcaagaaatttgactgatctagaatcaattcca
cctttagtagtttatatgccaaacacaagggagtccttcaacagtaacacatctacgttt
aaaatgtcgtactccacttccgaaaggtttaagatgatccaaaacggtttcgaagctgtc
accatgaaaaatctcactaaagatgagaactttatggggtgtatctcatgcgccatattg
agacggaaacaagaatcactaaattatacacttccatctgaatgtgatgcttgtttcgaa
aaatactgctggaatggaactgtcgatgccaccacccctatctcaagcactacatcctcc
tctgcaagttccacctcaacatctgattccggcaataaagaaaatagtgccagaattttg
gccccaagaagtacgctatctttgttgattggaggtttagctagtgtcttcatctctttc
tag

DBGET integrated database retrieval system