KEGG   Kluyveromyces lactis: KLLA0C06743gHelp
Entry
KLLA0C06743g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
kla  Kluyveromyces lactis
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    KLLA0C06743g
  Amino acid metabolism
   00380 Tryptophan metabolism
    KLLA0C06743g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     KLLA0C06743g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(590585..592126)
Genome map
AA seq 513 aa AA seqDB search
MLSLVLGIISSGILLSFLCLVCFPIGLPWSLPTIPIYVSFLPILTDMDQLEIFERYIRHP
MEKYGAVKIFFANRWNILTSKPEFLNIMFRDEDTFAKSGNQKKIPYSLLAKYTGDNVISA
HGKVWMKYRSCIQNQLNVFDSKPLIDNAQLFVKLLKKSIEDNTEGTVLLPPLIQRLTLAN
IAKIALGFDIGTLKFDEHDNICRSRLHEKLNQVKQQIFKPVFLSFPFLDLLPIKSRQRAK
IDIIQFRDMLLDTVYKNLIHNYKFEQTNNAAAGLIREWKLQGITDEQLKDNLVIILVAGH
ENPQLLLSTLFYLLAKHQNWQYAIREELLSVDRNEDILNSFKLTAFIYEALRMFPPLGQI
INRRTTRKCQLGPGIIIDKDVYCGYNVYGTGTATSVWGETAKQFIPERWGENSNELANNW
KKHKYDASMSAFHGGRRSCLGEKLALMEMKYVLYYVLMNFHIELHPQWKEKMTPAGPICP
KMLKVKLTILKDPQDQRSDSLYSSAGETLSENI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttatcacttgtgcttggaataatttcttcaggtatattactcagctttttgtgtttg
gtatgcttccctataggcttgccatggagcttaccaactattccaatttatgtttcgttt
ctacccatcctaacggacatggatcagctcgaaatatttgagcgatacattagacacccg
atggaaaagtatggtgctgttaaaatattcttcgctaatcgttggaatattttgacctcg
aagcctgaatttttgaacatcatgtttagagatgaagacacttttgctaaaagtggaaac
cagaaaaagattccatactcgttactagcgaaatatactggtgacaatgtgataagtgct
catggaaaggtctggatgaaatatagaagctgcatccaaaatcagctaaacgtctttgat
tcgaaacctttgatagataatgctcaattatttgtgaaattgctcaaaaagagcattgaa
gataatactgaagggaccgtccttttaccaccattgattcaaagattgacacttgcaaat
attgcaaaaattgctcttggatttgatattggcaccttgaagtttgatgagcatgacaac
atatgcaggagtaggcttcatgagaaattaaatcaagtgaagcagcagattttcaagcca
gtatttctatctttcccattccttgacttattacctataaaaagtagacagagggccaaa
attgatattatacaattccgggacatgcttcttgataccgtttataagaatctcattcat
aactataaattcgaacaaacgaataatgctgctgccggtttgataagagaatggaagttg
caaggtataactgatgagcaattgaaagataacctagtaataattttggttgcgggccac
gagaacccacaactacttttgtccacactcttttatttgcttgctaagcatcaaaattgg
cagtacgctataagagaggaacttttatcagttgatagaaatgaagatatcttgaatagc
tttaaattgaccgcctttatttatgaggctctaagaatgtttcctcctttaggccaaatt
atcaatagaaggacgacgagaaaatgtcagttgggtccaggaattattattgataaagat
gtttactgtggttataacgtttatggaacaggcactgctacatcagtatggggagaaaca
gccaaacaattcataccagaaagatggggagaaaattccaatgagctagcaaataattgg
aaaaagcataaatacgatgcatcaatgtctgcgtttcatggtggtagaagatcctgtctt
ggcgaaaaacttgctctcatggagatgaaatatgttctatactatgttttgatgaacttt
catattgaattgcatccacaatggaaggaaaaaatgacaccagccggaccaatttgtcct
aaaatgctcaaggtgaaattgaccatattaaaagatccacaagatcagagatcagattct
ctttactcaagcgctggggagacgttgagcgaaaatatataa

DBGET integrated database retrieval system