KEGG   Kluyveromyces lactis: KLLA0C06974gHelp
Entry
KLLA0C06974g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLLA0C06974g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0C06974g
Transcription machinery [BR:kla03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     KLLA0C06974g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(604344..605684)
Genome map
AA seq 446 aa AA seqDB search
MVCPHMNQVVSNQKLGDAVLKECETVRYLLRHADFKNRTMRTMRCMDCGEISCGSTFICL
QCGFCGCWNNNHFLDHSQKLGHIFGVNSSNGLVFCFRCGDFMADLVAEIPASQWDTVMEK
TELPASLHRDGLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVS
CALDEIACDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQL
HTDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSKTTIDPIMDLSLEIKNNPKL
EDCLDHFQREETLTDFHYECQSCKQNQGVVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKL
NDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGTVDQGHYTTVSKTEDGQWFKF
NDSVVTSVTEEQVLEQQAYLLFYIIR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtccgcatatgaatcaagtggtttctaaccaaaagcttggtgacgcagtgttg
aaagaatgcgaaacggtacgatatctgcttcgccacgcagacttcaagaatagaactatg
agaaccatgagatgtatggattgtggtgaaattagctgtggatcgactttcatttgcttg
caatgcggattttgcgggtgctggaataacaaccatttcttggatcattctcaaaaattg
ggacacatctttggggttaattcatcaaatggtctagtgttctgtttcagatgtggtgat
ttcatggctgatctggtcgctgaaattccggctagccaatgggatactgtaatggaaaag
accgagctaccagctagcttacacagagatggattacaaggtttggtgaacatgggatcc
acctgtttcatgagtagtatcattcaaaccatcatacataatccatactttgtcgaggac
ctgttatctcataagcattgcaacaattgtgacattaaatcaggaaccaagtgcgtctct
tgtgcattggatgaaattgcttgtgacttttacgggaatggacctgggacagggaagtct
tcctccgttagcaaaggctttgtaaaccttttatctgcatcatggcatatcaatcatcat
cttgttggctcgtcacaacaggatgcacatgagtactggcagttcttattgaaccaactg
catacggatcatgcacgagtattcggatcgtcaaaggcccctgattgtcaatgtatcacg
catcgaatcttccaaggatatcttaaaaacactttacagtgttctcagtgtggattctca
aagaccacaatagatccaatcatggacctttccttagagatcaaaaataaccctaaatta
gaagattgcttagatcacttccaaagagaggaaacattaaccgattttcactacgaatgc
caaagctgtaaacagaaccagggtgtggtgaaacagttaacgttgcataaggctcctaac
gtattagttatacagttgaaaagattcgaacatcaactcaacggtcaaagcgcaaaatta
aatgatagagtacagtttccattgcatttaaatctaaaaccccatttattccagattgaa
gatgaatatattcctaatattgcatatgatctactaaatgtagtctcccatcaggggacg
gttgatcaaggtcattataccacggtgagtaaaactgaagatggacaatggtttaaattc
aatgattctgttgtcacttcagtaacggaagagcaagtattggaacaacaagcatatcta
cttttctacattattcgttga

DBGET integrated database retrieval system