KEGG   Kluyveromyces lactis: KLLA0C07018gHelp
Entry
KLLA0C07018g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kla  Kluyveromyces lactis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KLLA0C07018g
   00670 One carbon pool by folate
    KLLA0C07018g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KLLA0C07018g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:607384..608169
Genome map
AA seq 261 aa AA seqDB search
MSTSKKVLMLHGYSQSDVIFRAKTAGMRKQLQKKGYELIYPCGPYKLHSKDFNDSEVDLR
DSEKSTGMYGWFLKDPETHSYTLEPELLEYLAQYIKENGPFDGIGGFSQGAGLAGYLSTD
LWSILPLNKEEQPPFKFAMYFSGFKFEPEQFQAPYETHPIQLKTLHIVGELDSLVTEERS
MKLFEACDPSTRTMVKHSGGHYIPNTKPFINMILSWLHAQADENLRELSGSEESAMKNTV
NNSDPQLDDDLLDMIDSFGKI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccaagaaagtgttgatgttacatggatactcccaatccgatgtcatattc
agagctaagacagcagggatgaggaaacagctacagaaaaagggatatgaactcatctac
ccctgtggaccttacaagcttcattccaaagacttcaatgattcagaagtggacttgaga
gattcagagaaatctactggcatgtatggctggttcttgaaggatccagaaactcatagc
tacacgctagaaccagaactgttagaatatctggcacaatatattaaagaaaacggtccc
tttgatggaattggtggattcagtcaaggtgctggactagcagggtatctatccactgat
ttatggtccattctgccgctaaacaaggaggaacaaccgcctttcaaattcgctatgtac
ttctccggtttcaaattcgaaccagaacagttccaagctccgtacgagacacatccaatc
caattaaaaactctacatattgtgggggaactagattccctcgttactgaagaaaggtca
atgaagttgttcgaagcgtgtgatccttcaacacgcactatggtaaagcattccggtggt
cactacattcctaatactaaaccgtttatcaatatgattttgagttggctgcatgcacaa
gcagatgaaaatttaagggaactttcgggttctgaagaatctgctatgaaaaacaccgtt
aacaactccgatccacaattggacgatgatttattagatatgattgactctttcggtaag
atctag

DBGET integrated database retrieval system