KEGG   Kluyveromyces lactis: KLLA0C08107gHelp
Entry
KLLA0C08107g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0C08107g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KLLA0C08107g
Enzymes [BR:kla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KLLA0C08107g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:710617..712245
Genome map
AA seq 542 aa AA seqDB search
MVSVKASAAEKKEFLQSQIDEIEKWWSEPRWKDTKRIYSAYEIAKRRGSVKPNTFPSTVM
SQKLFKILGEHAKNGTVSKTFGALDPVQVTQMSKYLDTIYVSGWQCSSTASTSNEPGPDL
ADYPMDTVPNKVEHLFKAQQFHDRKQWERICDGTIEESEIIDYLTPIVADGDAGHGGLTA
VFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRCVIPVQEHINRLITCRMAADVLGSDL
ILVARTDSEAATLLSSTADSRDHYFILGASNPAVKGKPLNDLLNKAILDGATIDDLQTIE
KEWLAKADVKLFHEVFADAAKAAGKDQSVIDQFNSKVNPLSETSIYEMQALAKELLGTEL
FFDWDLPRGREGLYRYQGGTQCSVMRARAFAPYADLCWMESNYPDYEQAKEFAEGVTAKF
PGKWMAYNLSPSFNWTKAMSVDEQETFIQRLGDLGYIWQFITLAGLHTSGLAIEQFSKNF
AKLGMKAYAQDIQKKELDNGIDMVKHQKWSGAEYIDGLLRLAQGGLAATAAMGQGVTEDQ
FK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtctccgttaaggcttctgctgctgaaaagaaggaattcttacaaagtcaaattgac
gaaattgagaaatggtggtccgaacctcgttggaaggacaccaaacgtatctactctgct
tacgaaattgcaaagagacgtggttcagtaaaaccaaatactttcccatctactgtgatg
tctcaaaaattgttcaaaatcttgggggaacacgctaagaacggcactgtctccaagact
ttcggtgctttggaccctgttcaagtgacccaaatgtctaagtacttggataccatttac
gtttcaggctggcaatgttcttccactgcatcaacttctaacgaaccgggtccagatttg
gctgattacccaatggacactgtaccaaacaaagtggagcatttgttcaaggctcaacaa
ttccatgacagaaaacaatgggaacgtatctgtgatggtaccattgaagaatctgaaatc
attgactatttgactccaatcgttgctgatggtgacgctggtcatggtggtttgactgct
gtcttcaagttgacaaaaatgttcatcgaaagaggagctgccggtatccacattgaagat
caaacttctacaaacaaaaagtgtggtcacatggctggtagatgtgttatcccagtacaa
gaacatattaacagattgatcacttgtagaatggctgcagatgttttgggttcagatttg
atccttgttgccagaactgattctgaagccgctactctattatcctctactgccgattca
agggaccattacttcatcttgggtgcttccaatccagccgtcaagggtaaaccattgaac
gatttactgaacaaagctatcttggacggtgccaccatcgatgacttacaaaccatcgaa
aaagaatggttggccaaggccgacgttaagctgttccacgaagtattcgctgacgctgcc
aaggctgcaggtaaggaccaatccgtaattgaccaattcaacagcaaagtcaacccatta
agtgaaacatcaatctatgaaatgcaagccttggccaaggaattgttgggtaccgaattg
ttcttcgactgggacttgccaagaggccgtgaaggtttgtaccgttaccaaggtggtact
cagtgttctgtgatgagagctcgtgcctttgctccatacgctgatctatgttggatggaa
tctaactaccctgattacgaacaagctaaggaattcgctgaaggtgtcacagctaagttc
ccaggcaagtggatggcttacaacttgtcaccatctttcaactggacaaaagctatgtct
gtcgacgaacaagagacattcattcaaagattgggtgacttgggttacatctggcaattt
atcactttagctggtctacatacaagtggtttagccatcgaacaattctccaagaatttc
gccaagttaggaatgaaggcatatgctcaagatatccaaaagaaggaattggataacggt
atcgacatggtaaagcaccagaaatggtctggtgctgaatatatcgatggtctattaaga
ttagcacaaggtggtctcgctgccactgctgctatgggtcaaggtgtcactgaggatcag
ttcaaataa

DBGET integrated database retrieval system