KEGG   Kluyveromyces lactis: KLLA0C10296gHelp
Entry
KLLA0C10296g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kla  Kluyveromyces lactis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLLA0C10296g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KLLA0C10296g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KLLA0C10296g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:883644..884900
Genome map
AA seq 418 aa AA seqDB search
MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKT
MNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQN
TISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNP
RANPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSD
TPENISKIVLYMQERDDGVNELTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHHHLKNR
QFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVRDSD
GNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRENLAFPPH
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcagttcgtcatagtcataaaattgggatcttcatcactagttgatgaagag
accaaagaaccaaaactttctatcatgtcattgattgtggagactgtggtaaagttacgc
agaagaggacacaaagttatcattgtatctagtggaggtatcgccgtcggattgaaaacg
atgaatatgaagggaaggccaaagaaactatccaaggtgcaagcaatcgcagctgtgggc
caaggcagattaattgggaggtgggattccttgttctctgaatttgatcagagaattgct
caaatcctaattactcgaaatgacattgttgattggactcagtataagaatgcacagaat
actattagtgaattactttccatgggagtagtgccaatcgttaatgagaatgacacttta
tctgtgagcgaaatcaaatttggtgataatgatacattatcagctatcacagcagcgttg
actggtgctgattatctatttttattgacagatgttgactgtttatacactgataatcca
agagcaaatcccgatgcaaaacctatcttggttgttccagatatatcacaaggattgcca
ggtgtgaacacagacggtggatctggatcagatgttggaactggtggtatgaagactaag
cttattgcggcagaattagcaaccaatgctggtgtccataccatcattatgaagagcgac
actccagaaaacatttccaaaattgttctctacatgcaggaaagggacgatggcgtgaat
gaacttacacaagatttggctgacctacaactcactgagatgcaaagtttagttaataat
catgttcctcttcatactaggtttattgccaatagtaatcatcatcacttgaagaacaga
caattctggatgcttcatggactcgtcagtcaaggcgctgtaattatagacattggtgca
tacgaagcgttaacgaggaaaaacaaagctggtttgttacctgcaggcgttattgaagtc
caagggagcttccatgaacatgaatgtatagatataaaattgggagtcagggattcagat
ggaaatttggataaatccgttgcactgaaaacagtaggtagggctcgttgcaactataca
agcacagagttatcaaaaattaaaggtctgcaaagtgatcagattgaagatattctaggc
tatgctgatagtgaatacgtagctcatagggaaaatttagcattccctcctcattaa

DBGET integrated database retrieval system