KEGG   Kluyveromyces lactis: KLLA0C14300gHelp
Entry
KLLA0C14300g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
kla  Kluyveromyces lactis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kla00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1242952..1243842
Genome map
AA seq 296 aa AA seqDB search
MPIEETETEIILTHPNNSSTKARILKYGATVFSWELKGEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNHDDEHLSKLPQHGLARNSVWEFLGQVKSNPPTIQLGLGPEFANEELTNLW
PFEYSLVLSVELGDEYLKTEIEVLNTSTTQNLKFNWLFHTYLKIDDIEDTLVSNLSSTKL
YDQLLKESYIDRQPVISVHEELDRIYQNVDEDRIIQVIDKGYPIHTLKRHNLPDTVVWNP
WVEKSKGMADFEPKDGFKNMVCVEPGHVHDFVVLAPGENWVASQILYKDELKFQKV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgaggaaactgaaactgaaatcatcctgacacatcctaacaattcatcaaca
aaagcaagaattctaaagtatggtgccacggtattttcctgggaattaaaaggtgaagag
caattatggttatctactgctgctaagctcgatggttccaaaccggttcgtggtggtatt
ccattagtttttccagtttttggtaagaaccatgatgatgaacatctaagtaaattacca
caacacggtttagcaagaaattccgtatgggaatttttgggccaagtgaagtctaaccct
ccaaccattcagttaggcttgggacctgagtttgctaatgaagagctaaccaacttgtgg
ccatttgaatactctttggtgctatcagtagaacttggtgatgaatacttgaaaactgaa
attgaggtactaaatacaagcactacgcaaaatttgaagttcaattggttattccatact
tacttgaaaattgatgacattgaagatacgttggtttctaatttgagcagcaccaaattg
tacgatcaactattgaaggaaagctatattgacagacaacctgtgatttctgtgcatgaa
gaattagatagaatttatcaaaatgttgacgaagacagaatcatccaagtgatcgataag
gggtacccaatccataccttgaaaagacacaacctaccagatactgtcgtttggaatccg
tgggtggaaaaatctaaaggtatggcagattttgaaccaaaggatgggtttaaaaatatg
gtgtgtgtcgaaccaggtcatgttcatgatttcgtggttttggcaccaggcgaaaactgg
gttgcctcccagattttgtataaagatgaattgaagttccaaaaggtctaa

DBGET integrated database retrieval system