KEGG   Kluyveromyces lactis: KLLA0C16577gHelp
Entry
KLLA0C16577g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
kla  Kluyveromyces lactis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLLA0C16577g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     KLLA0C16577g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   KLLA0C16577g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1451181..1452695)
Genome map
AA seq 504 aa AA seqDB search
MITRTQNGSMLLNRINHEPSNDSAEGSCNSLFKPKTLKRKNLKHLTLESSCSSSSSSPDE
IPKGFSNGNGPTLSLMLEKLPVREEISPISRDTSFQTVSFLQGSSSTSDISSIVSGTTPT
TRDAPMSLTPTGVSMMQQETDETATLTTQIARLSLTPENGIQLENLVRLSKIGAGNSGTV
VKTLHVPDSRIIAKKTIPVENKEVLKNQLVRELTIMKNVSAHDNIVGFYGAFYNPSTTNE
IVILMEYMDCGSLDKILSVYRSDCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYLYDC
YKIIHRDIKPSNILINSKGDVKICDFGVSTTLINSLADTFVGTSTYMSPERIQGGRYTTK
GDVWSLGLMIIELSSGEFPLGGHHDTPEGILDLLQRIVNEPAPKLSKNEHYSIEMTDFVN
RCCIKEERGRSSLKELICHDFICKYNNRDTIAKEFRHWCKKVKKRIKEDKMIRREETERS
KIEKRQLEKAALAVTAARSSSTRR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgattacacgtacccaaaacggctcgatgttattgaatcgaataaaccatgaaccgtcg
aatgatagtgcagagggatcgtgcaatagtttgttcaaaccgaagactttgaaacggaag
aatttgaagcatttgactctagaatcatcatgttcatcatcatcttcctctcctgacgaa
ataccgaaaggttttagtaatggaaatggtccaacactcagtttgatgttggagaagctt
ccggtccgtgaggaaataagtccaattagcagagacacttcattccagacggtttcattc
cttcaagggagttctagtacatcagatatatcttccattgtcagcgggactacaccaacc
acaagagatgctccaatgtcacttactcctacaggagtcagtatgatgcaacaggagaca
gatgaaacggccacattgactactcagattgctcgactttctttaaccccagagaacgga
attcaactcgaaaaccttgtacgattgagcaagattggagcgggaaattcgggtactgtg
gtgaagactttgcatgtacctgattctagaatcatagctaagaaaactataccagtagag
aataaggaagtgctgaaaaatcaacttgttagagaactaaccatcatgaaaaatgtttca
gcccatgataacattgttggtttctacggtgcattttacaatccatccaccactaacgaa
atagtgattcttatggaatatatggattgtggctcgttagataagattttgtcagtttac
agatctgattgccataggaaaaacgtttctatatcgtgcaagacatcgtggttcaacgaa
atgcctctctcaaggatctccttttgtgttttaaatggacttatctatctttatgactgc
tataaaatcattcacagggacatcaaaccgtccaatatattgataaactcgaagggagac
gtaaagatctgcgattttggtgtctctactactctaattaactctcttgcggataccttt
gtcggaacctccacttacatgtcacctgaacgtatccaaggtggcagatatactactaaa
ggtgatgtgtggtcattaggtcttatgatcatcgagctcagtagtggtgagttcccacta
ggtggacatcacgacacaccagaagggattcttgatcttttacagagaattgtcaatgaa
cctgctccaaaactgtcaaaaaatgaacattactccatagaaatgacagatttcgtgaac
aggtgttgcattaaggaggagagaggacgatcatctttgaaagaattgatatgtcatgat
ttcatctgtaagtataacaacagagacactattgcaaaagaattcaggcattggtgcaaa
aaagtgaagaagcggatcaaagaggataagatgataagaagagaagagacagagagaagt
aagatcgaaaaaagacaattagagaaagcagcgttggctgttacagccgcaaggtcttcg
agtacaaggcgatga

DBGET integrated database retrieval system