KEGG   Kluyveromyces lactis: KLLA0D00638gHelp
Entry
KLLA0D00638g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
kla  Kluyveromyces lactis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KLLA0D00638g
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    KLLA0D00638g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     KLLA0D00638g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(60190..63120)
Genome map
AA seq 976 aa AA seqDB search
MDPFMVSCYMMTSQKRLVEPSMRLEFNDVDDEHQAIMPQSILRSLSLEDGSNSDMSSKST
APSSGSEESFVYDHIYKGIKGFLSRRPSFNGHGNSNNNPNKNKTSQLGGPLTYALSSNLR
LESTDSGFGSFSADPLDLPLLKVTRRKRVRYTFHIDQNTISWNNGKKLIYVDTIKDIRSG
DMATNYMDMYNVPCPSRDLWCTIIYSVNKNRLKALHVIAEDAAVFKSFYETTVNLVNSRR
KLMEDIAVPNNEQFANIHWQTSVSTKKEDQDKDTLSFADVKRLCNRYHIYCSDNYLYALF
IKADTNNNSLLNFPEFQDFVKYLKARPEIEIIWNQMKNKDTKVVDFQSFYQFICDVQGEV
ISQTNAYKIFKKYCTADELLDVEGLLKFLTKQPFLQLFEEDYSRPLNEYFISSSHNTYLM
GKQVVDEVSVEAYTRALQQGCRCIEIDIWQGDHGPVVCHGLFTQSIPLEDVVKTIRKYAF
ITSPYPLIVSLEIHCKKDYQLMITKIMKEILGDLIFVIPPNTSLLSPEQLKNRIILKSKK
THAVESEIISGSTSSYTSSSSHESLSETNDMRLIKKRGLQKSTTSSTSPNTTTVPVTTKR
NNKSLLLSTKIMISDKVHEISGIHGVRFRNFSLPESKTTTHCFSLSEKKFINLDKDETQK
LAINKHNRRHLMRIYPHMLRYKSSNFNPIRFWKEGVQMVATNWQTYDLGQQLNHAMFQVS
LDRNSIWHSGYVLKPAHLRKEIHKMKDIPVIMERLKREKIHIHLDVISGQMLSLQNCKIL
APFVEIELITDNTMESLHLTNCLQPMGYTSNNSTHATGITSMSNASNGTFANITSTSTKR
VDSNGSSGKTEPLCESNGTTVISGLSAEDGILSTPSAPPAVSVPVLSSPQLFSTKCFRDN
GFSPVWNASFECTLTNTTFNFVRFTVKNSTQTIATTCVRLNYLKQGYRHLPLYNIKGEKF
IFSTLFIRYKEELLKW
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggatccgtttatggtttcctgctatatgatgacaagtcagaaacgtctcgttgaaccc
tcgatgaggcttgagttcaacgatgtggatgatgaacatcaggctattatgccacaaagc
attttgaggagcctttctttggaagatgggtccaatagtgatatgagctcgaagagtact
gctccctcctcgggaagtgaggaatcctttgtgtatgatcatatatacaagggcatcaag
ggctttctttctagaagacctagttttaatgggcatggaaattctaataataacccgaac
aaaaataagacgtcccaacttggtggccctctcacatatgcattgtcgagcaacctcagg
ttagagtcaacggattctgggtttgggtccttctcggcagatccattggacttgcctcta
cttaaggtgacacgacggaaacgtgttcggtacaccttccatatagaccagaatacaata
agttggaataacggaaaaaagctgatatacgttgataccatcaaagatatacggagtggt
gatatggctaccaattatatggatatgtacaatgttccttgtccttcacgggacctttgg
tgtactatcatctattcagtgaacaaaaacagattaaaggctttacatgttattgcggag
gacgctgcagtattcaaatctttttatgaaacgacagtaaatttggtgaattctaggagg
aaactaatggaagatattgcagttccaaacaatgaacaattcgccaatattcattggcag
accagtgtttccacaaagaaagaagaccaggacaaagatacgttaagtttcgcggatgtg
aagagactttgcaaccgatatcatatctactgttctgataactacctttacgcacttttc
attaaagcggacactaacaataacagtttgcttaatttccccgaattccaagattttgtc
aagtacttaaaagctaggccggagattgaaataatctggaatcaaatgaaaaataaggat
actaaggtggttgactttcaaagcttttaccagttcatatgtgacgttcaaggtgaagta
atatcacagactaatgcttataagattttcaaaaagtattgcaccgctgatgaactttta
gatgttgagggtttattaaaattcttaacaaaacaaccgttcctacaattattcgaagaa
gattattctagaccgctaaacgaatatttcatatcatcatctcataacacttatcttatg
gggaagcaagtggtggacgaggtaagtgtcgaagcttatactcgtgctttgcaacaagga
tgccgttgtatcgaaatagacatatggcaaggagatcatgggcctgtggtatgccatggt
cttttcacacagtcaatccccttagaagatgttgttaaaacgatacgaaaatatgcgttt
atcacttcaccttatccgcttattgtatctctagagatccactgtaagaaggattaccaa
ttaatgataacgaaaattatgaaggaaattttgggagatcttatattcgtaattccacca
aacacttcactattatcaccagagcagctgaaaaatcgcattatattgaaaagtaagaag
acgcatgctgtagagtctgaaattataagtggatcaacttcatcctatacgtcttcttcc
tctcatgaatcactttctgaaacaaatgacatgcggttaatcaagaagcggggcttacaa
aaaagtactaccagtagcacttctccaaatacgacaacagttccagtgacaacaaagaga
aacaacaaatcgttattgttatcaacaaagatcatgatatcagacaaggttcatgaaata
tctgggattcacggagtaagattcagaaacttttcgttgcctgaatcaaaaaccactacg
cattgcttctcactaagtgagaagaagtttatcaatcttgacaaagatgaaactcaaaaa
ctcgctatcaacaagcataaccgcagacatttaatgagaatctatccgcacatgttgcgg
tacaaatcctccaatttcaacccaatacgattttggaaagaaggagtacaaatggtcgca
acaaactggcagacgtatgacctgggacaacaattgaaccatgcaatgttccaagtttca
ctagatagaaattccatctggcattctgggtatgttttgaagcccgctcacttgcgaaaa
gagatacataaaatgaaggacattccagtaattatggaaaggctcaaacgggagaagatt
catatccatttggacgtaatttctggccagatgttatccttacaaaactgcaagatacta
gcaccattcgtagaaatcgaactcattactgacaataccatggaatcacttcaccttacc
aactgcttgcagccaatggggtatacttccaataactctacccatgctaccggaattact
agcatgagtaatgcttcaaatggtacttttgctaacattactagtacctcaaccaagcgc
gttgatagcaacggcagcagcggtaagactgaaccactttgtgaaagtaatggaaccact
gttatttcaggtttgtccgcggaagacggaatactcagtactccatctgctcctccagca
gtatctgtacctgtccttagttcaccgcaactattttcgacaaaatgcttccgtgataac
ggcttcagtcccgtgtggaatgcgtcgttcgagtgtacacttacaaacactacgttcaac
ttcgtgcggtttacagtcaagaactccacgcaaactatcgcaacaacgtgtgtacggttg
aattatttgaagcaagggtataggcacttaccgttgtacaacataaaaggggagaagttc
atattctccactctattcatacgctacaaagaggaacttctaaaatggtga

DBGET integrated database retrieval system