KEGG   Kluyveromyces lactis: KLLA0D02486gHelp
Entry
KLLA0D02486g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
kla  Kluyveromyces lactis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLLA0D02486g
Enzymes [BR:kla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLLA0D02486g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:210629..211615
Genome map
AA seq 328 aa AA seqDB search
MMYTRLLYALFLLVELAFGANFYDRDENIMELTPSNFDKVIHRTNYTTLVMFYAPWCGYC
QELKGSMKSAGKILSGMVQVAGVNCDESVNKQLCAQNRVSGFPTLMVFRPPKINLDNPKK
NSNGAASQHATEVYKGERKLKPIVDFALSRVKNYVKRLNRYSKFEELLKSSRTRYAVVLI
SKKEKIPTLYKSVALDWLGIYDFYSIWDEKLQGVSQLSFENDTKNWPNTVKYLQSLEKSE
TELQSPRIVVIDRETDTYDELDILKTTDKNDIATFLSKFESKPREGPLSKRQEYLKSILN
KSKSKKSKTKKNKQKTKLTKDDIVQDEL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacacacgtcttctatatgcattgtttttgttggtcgaactggcgttcggagcc
aatttctacgaccgtgatgagaatatcatggaattgacaccttctaacttcgataaagtc
attcataggaccaattacaccactttggtcatgttttatgctccgtggtgtggttactgt
caggaattgaaaggttccatgaaatctgccggtaaaatcctctctggaatggtacaagtt
gctggagtgaactgtgatgaaagtgtgaataaacaattatgtgcacagaacagagtatcg
gggttcccaacgttaatggtattcaggcctccaaagatcaatttggataacccaaagaaa
aattccaatggtgctgcgtcacagcatgccacagaagtgtacaagggagaaaggaaattg
aagcccattgtcgatttcgctttatctagagtgaaaaactacgtgaagcggttgaaccgt
tacagtaagttcgaagaactattaaaatcttcaagaaccaggtacgctgtagtgcttatc
tcaaagaaggagaagattccaactttatataaatctgtagccctcgattggcttgggatc
tacgatttctattcgatctgggacgagaaattgcaaggcgtgtcacaattgagttttgag
aacgatacaaagaattggccaaatactgttaaatacctccaatcgttagaaaaaagtgaa
actgaattacaatcgcccagaatcgtagtgatagatagagaaacagatacttatgacgaa
ctagacatattaaaaactacagataaaaatgacattgcaacgttcctttcgaaattcgag
tcaaaaccaagggaaggtccactcagtaagagacaagaatacctcaaatctattttgaat
aaatcaaagtcaaagaagtccaagactaaaaagaacaaacagaagactaaacttacgaag
gacgacatagttcaggatgagttgtag

DBGET integrated database retrieval system