KEGG   Kluyveromyces lactis: KLLA0D02992gHelp
Entry
KLLA0D02992g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
kla  Kluyveromyces lactis
Brite
Protein phosphatases and associated proteins [BR:kla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     KLLA0D02992g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(253918..254445)
Genome map
AA seq 175 aa AA seqDB search
MGAAPSRIVDNLLDDTNFDRAEIERLKKRFMKLDKDSSGSIDKTEFMSIPGVSANPLAKR
IIEVFDEDNSGDVDFQEFITSLSIFSGRGETDAKLRFAFRIYDIDKDGYISNGELFIVLK
IMVGTNLEDEQLQQIVDRTIMENDVDGDGKLSFEEFKKAAETTEVIQSLTLQHNI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagcaccatctaggatagtggataatttgttggatgataccaacttcgatcgt
gcggagattgaaagattgaagaaacggtttatgaaacttgacaaagatagctcaggttcc
atcgacaagaccgaattcatgtctatacctggagtatcagcgaacccacttgcgaagaga
ataatagaagttttcgatgaagataatagcggagatgttgattttcaagaattcataacg
agtttatccatcttcagtggaagaggggagacggatgcaaaactacgttttgcattcagg
atctatgacattgataaagacggttacatatccaatggtgagttatttatcgttttgaaa
ataatggtaggcacaaacttagaggatgagcaactacagcaaattgtggatagaaccata
atggaaaatgatgttgatggagatggaaaattatcattcgaagagtttaagaaggcggcc
gaaacaacagaagtaatccagtcattgacgctacagcacaacatatga

DBGET integrated database retrieval system