KEGG   Kluyveromyces lactis: KLLA0D03190gHelp
Entry
KLLA0D03190g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
kla  Kluyveromyces lactis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    KLLA0D03190g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     KLLA0D03190g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   KLLA0D03190g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:267933..269051
Genome map
AA seq 372 aa AA seqDB search
MEYQPVNLQQMNTAPAPATNPVNPADVTVGSQSTDYLLAQQKESLLPQRSTVSKGKYTLH
DFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEHP
FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHN
IIYRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLCGTPDYIAPEVITTKPYNKSVDW
WSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLITADLTRRL
GNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQYPEEQLDYGVQ
GEDPYGQYFLDF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcagcctgtgaatttacaacagatgaatactgctccagctcctgcaaccaat
cctgtgaatccggcggatgtgaccgtgggttcacaatctaccgattatttattggctcag
cagaaggaatcgttgttgcctcaaaggtctactgtgtctaaggggaaatatacgttgcat
gattttcaaatcatgcgtacattgggaacagggtcattcggtagagtgcatctcgtgagg
agtgtgcacaatggacgttactatgccatcaaagttttgaaaaaacatcaaatcattcga
atgaagcaaattgagcatacgaatgatgaaagacggatgttaaagctggttgaacatcct
ttcttaattcggatgtggggtacgttccaggattctcgtaatctattcatggttatggat
tatatcgaaggtggtgaattgttctcgttgctcagaaaatcccaacgattccccaaccct
gtggctaagttttatgcagcagaggtgactttagctttggaatacttacattctcataac
ataatataccgtgacttgaagccagaaaacattctattggataggaatgggcatatcaag
ataacggattttgggttcgccaaagaggtaatcacagtgacgtggacgttatgtggtacc
cctgattacattgctcctgaagtaattacaacgaaaccatataacaagtctgttgactgg
tggtctcttggaatcttaatcttcgaaatgctcgctggttatactccattttatgatgtt
acgccaatgaagacctatgagaaaatcttagctggtgaagtcgtttatccaccatttttc
caccctgatgttgtggatctattaggtaagttgatcactgcagatttgacccgtagatta
ggtaacttacaaagcgggccagatgatatcaaatcgcatccatggtttgcggaagttata
tgggaaaagcttgtggcaaaggacatcgagacgccgtacgagccaccaatcgctgtcggt
gtcggtgattcctctttgttcgaccaatatccggaagagcaactggactatggcgttcag
ggcgaagatccatacggccaatactttttagatttctaa

DBGET integrated database retrieval system