KEGG   Kluyveromyces lactis: KLLA0D04488gHelp
Entry
KLLA0D04488g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
kla  Kluyveromyces lactis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kla00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(381861..382751)
Genome map
AA seq 296 aa AA seqDB search
MFARLSRSNKFLPIALGVGAASIATAIILQRNYSIMNDTSKAFLGDNEWIDLPIIKIEKL
SHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPYTPVSDNGTKGKMELVVKH
YENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDSITLLGAGTGINPLYQLVHHIAEN
PEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVKITYFVDKAEGNFEGETGFITKDY
LSHQAPKPSEKNQVFVCGPPPFMKAYSGPKVSPQDQGELTGILAELGYSKSNVFKF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctagactgtccagatctaataagtttttgccaattgccctcggtgttggtgct
gcttccattgctactgctattattctacaaagaaattattcgatcatgaacgacacttcc
aaagcctttttgggtgataacgaatggattgatttaccaatcatcaagatcgagaaattg
tctcatgataccaagagatttacttttgctttgccaaagaaggatcaagtttctggtttg
atcactgcctcttgtatcttggccaagttcgttactccaaagggttctaacgtcattaga
ccatacactccagtgagtgacaacggtaccaagggtaagatggaattggtggttaagcat
tacgaaaacggtaagtttacctctcatttgttcggtttgaaggaaaacgataccgtttcc
tttaaaggtccaattactaagtgggagtggaagccaaactcttacgattccatcactttg
ttaggcgctggtaccggtattaacccattgtaccaattagttcaccatattgctgaaaac
ccagaggataacaccaagatccatttgtactacggtaacaagactccagaagacatcttg
ctgaagagcgaattggacaacttgcaaaagaagtaccctgatcaagtcaagatcacatac
ttcgtcgacaaggcagaaggcaacttcgaaggtgaaactggtttcatcaccaaggactac
ttgtctcatcaagctccaaagccatccgaaaagaaccaagtcttcgtctgtggtcctcct
ccattcatgaaagcttattctggtccaaaggtctccccacaagaccaaggtgaattgact
ggtatcttggctgaactaggttactccaagagtaacgtcttcaagttctga

DBGET integrated database retrieval system