KEGG   Kluyveromyces lactis: KLLA0D04928gHelp
Entry
KLLA0D04928g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
kla  Kluyveromyces lactis
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:kla00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:kla04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(422549..424042)
Genome map
AA seq 497 aa AA seqDB search
MTMTLLRGVSVFSRRVPVAGGFGYLKRADISNVVLQGRTYASAKVALAEDLTLETHTDNQ
AAAIEQANERAVSNPDVLDSGIHSLQHAYRESGEYGTRPIYLDMQATTPTDPRVLDTMLK
FYTGLYGNPHSNTHSYGWETNKEIEQARKYIADVIKADPKEIIFTSGATESNNMALKGVS
RFYKKTRNHIITTRTEHKCVLEAARAMKNEGYEITFLNVDEQGLINLEELEAAIRPETCL
VSVMAVNNEIGVMQPLKEIGELCRKRKVFFHTDAAQAYGKIPIDVNEMKIDLMSISSHKI
YGPKGIGAIYVRRKPRVRLDPLISGGGQERGLRSGTLAPPLVAGFGEAARLMMKEYENDS
NHIKRLSDKLMNALLSIDHTILNGSADHRYPGCVNISFAYVEGESLLMALRDIALSSGSA
CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFTTDEEIDYVIKAITERVDFLRELSPLW
EMVKEGIDLNSIEWSGH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgacattgttaagaggagtgagtgttttttccaggcgtgtgcccgttgctggt
ggttttggctatttgaagcgtgctgatattagtaacgttgttttacagggacggacgtat
gcaagtgccaaggttgccttagcagaagatttgactttggaaacgcatacagataaccaa
gcagcagctattgagcaagccaacgaaagagccgtgtcaaatcccgatgttttggacagt
ggtatacattctttgcaacatgcataccgtgaatccggggaatacggtacaagacctata
tatctcgacatgcaagctaccactccaacagacccaagagttctagataccatgttgaaa
ttctacacggggctttatggtaatcctcattcaaatactcatagctatggttgggaaact
aacaaggagatcgaacaagcaagaaaatacatcgccgatgttatcaaagctgatccaaag
gagataatcttcacttccggtgctacagaatcaaataatatggctttgaagggtgtctca
aggttttacaagaagacaagaaaccatattatcactacaagaactgaacacaagtgtgtg
ttagaagccgccagagctatgaagaacgaaggatacgaaatcacatttttgaatgttgat
gagcagggtttgatcaatttagaagagttggaagctgcgatcagacctgaaacttgttta
gtttctgttatggccgtcaacaacgaaattggtgttatgcaaccattgaaagaaattggt
gaactttgtagaaaacgcaaagttttcttccataccgatgcagcgcaagcttatggtaag
atacctatcgatgtgaacgaaatgaaaatagatctgatgtccatttcctcacacaaaatt
tatggtccaaagggaattggtgccatttacgttagaagaaagccaagagtcagattagat
ccgcttatctccggtggtggtcaagaaagaggtttacgttctggtacattggctccacct
ttggttgccggcttcggggaagcagcaagattgatgatgaaagaatacgagaacgactca
aatcacattaaaagattatctgacaaattaatgaacgctttgttatctattgaccataca
atcttaaacggttctgctgaccatcgttacccaggttgtgttaacatttcattcgcatat
gtcgaaggtgaatccttattgatggctcttagagatattgctttgagttctggttctgct
tgtacttcggcatctttagaaccatcttatgtgttgcatgcattgggtaaagatgatgct
ttagcacactcttccatcagattcggtattggtagattcaccactgatgaagaaattgat
tacgttatcaaggctatcacggaaagagttgatttcctaagagagttgtccccattatgg
gagatggtcaaggaaggtattgacttgaactccatcgaatggtcaggtcattaa

DBGET integrated database retrieval system