KEGG   Kluyveromyces lactis: KLLA0D04928gHelp
Entry
KLLA0D04928g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
kla  Kluyveromyces lactis
Pathway
kla00730  Thiamine metabolism
kla01100  Metabolic pathways
kla04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KLLA0D04928g
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    KLLA0D04928g
Enzymes [BR:kla01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     KLLA0D04928g
Transfer RNA biogenesis [BR:kla03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    KLLA0D04928g
 Prokaryotic Type
    KLLA0D04928g
Mitochondrial biogenesis [BR:kla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    KLLA0D04928g
Prokaryotic defense system [BR:kla02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   KLLA0D04928g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Pyridoxal_deC DUF2188
Motif
Other DBs
NCBI-GeneID: 2892720
NCBI-ProteinID: XP_453279
UniProt: Q6CS10
Position
D:complement(422549..424042)
Genome map
AA seq 497 aa AA seqDB search
MTMTLLRGVSVFSRRVPVAGGFGYLKRADISNVVLQGRTYASAKVALAEDLTLETHTDNQ
AAAIEQANERAVSNPDVLDSGIHSLQHAYRESGEYGTRPIYLDMQATTPTDPRVLDTMLK
FYTGLYGNPHSNTHSYGWETNKEIEQARKYIADVIKADPKEIIFTSGATESNNMALKGVS
RFYKKTRNHIITTRTEHKCVLEAARAMKNEGYEITFLNVDEQGLINLEELEAAIRPETCL
VSVMAVNNEIGVMQPLKEIGELCRKRKVFFHTDAAQAYGKIPIDVNEMKIDLMSISSHKI
YGPKGIGAIYVRRKPRVRLDPLISGGGQERGLRSGTLAPPLVAGFGEAARLMMKEYENDS
NHIKRLSDKLMNALLSIDHTILNGSADHRYPGCVNISFAYVEGESLLMALRDIALSSGSA
CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFTTDEEIDYVIKAITERVDFLRELSPLW
EMVKEGIDLNSIEWSGH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgacattgttaagaggagtgagtgttttttccaggcgtgtgcccgttgctggt
ggttttggctatttgaagcgtgctgatattagtaacgttgttttacagggacggacgtat
gcaagtgccaaggttgccttagcagaagatttgactttggaaacgcatacagataaccaa
gcagcagctattgagcaagccaacgaaagagccgtgtcaaatcccgatgttttggacagt
ggtatacattctttgcaacatgcataccgtgaatccggggaatacggtacaagacctata
tatctcgacatgcaagctaccactccaacagacccaagagttctagataccatgttgaaa
ttctacacggggctttatggtaatcctcattcaaatactcatagctatggttgggaaact
aacaaggagatcgaacaagcaagaaaatacatcgccgatgttatcaaagctgatccaaag
gagataatcttcacttccggtgctacagaatcaaataatatggctttgaagggtgtctca
aggttttacaagaagacaagaaaccatattatcactacaagaactgaacacaagtgtgtg
ttagaagccgccagagctatgaagaacgaaggatacgaaatcacatttttgaatgttgat
gagcagggtttgatcaatttagaagagttggaagctgcgatcagacctgaaacttgttta
gtttctgttatggccgtcaacaacgaaattggtgttatgcaaccattgaaagaaattggt
gaactttgtagaaaacgcaaagttttcttccataccgatgcagcgcaagcttatggtaag
atacctatcgatgtgaacgaaatgaaaatagatctgatgtccatttcctcacacaaaatt
tatggtccaaagggaattggtgccatttacgttagaagaaagccaagagtcagattagat
ccgcttatctccggtggtggtcaagaaagaggtttacgttctggtacattggctccacct
ttggttgccggcttcggggaagcagcaagattgatgatgaaagaatacgagaacgactca
aatcacattaaaagattatctgacaaattaatgaacgctttgttatctattgaccataca
atcttaaacggttctgctgaccatcgttacccaggttgtgttaacatttcattcgcatat
gtcgaaggtgaatccttattgatggctcttagagatattgctttgagttctggttctgct
tgtacttcggcatctttagaaccatcttatgtgttgcatgcattgggtaaagatgatgct
ttagcacactcttccatcagattcggtattggtagattcaccactgatgaagaaattgat
tacgttatcaaggctatcacggaaagagttgatttcctaagagagttgtccccattatgg
gagatggtcaaggaaggtattgacttgaactccatcgaatggtcaggtcattaa

DBGET integrated database retrieval system