KEGG   Kluyveromyces lactis: KLLA0D07304gHelp
Entry
KLLA0D07304g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
kla  Kluyveromyces lactis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:kla04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:623352..624749
Genome map
AA seq 465 aa AA seqDB search
MASMFRPPESRRTNSKPPKLSLPPQLVSNSKPITDIRDEKLRQPPSKSVPSSATPTSSAS
ASSARTLKNRPVPPPTASSVTPLSSTNSGSAMGSLSNKLHGLKINTDHLPTSGSQQSTQS
ADSMTSNLISMYDSEPTTSSSTSLVNHGKESEIIEHDRDDSTDELESDIWQTYKIHEQID
TLGILGEGTGGSVTKCKLRNGSKIFALKTIATIENDGSEKQIFRELQFNKSCKSDFIVRY
YGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGLFYLHER
KIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNSLATTFTGTSYYMAPERIQGQPYSVTS
DVWSLGLTLLEVAQGHSPFDTDKLAANMPPIELLMLILTFTPELKDEPEQGIVWSKSFKS
FLDYSLKKDSKDRPSPRQMLQHPWMVGQTKKHVNMKKFIQTCWAD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgttccgaccaccagagtctaggagaaccaattccaagcctccaaaattg
tcgttaccaccgcaattggtttccaatagtaagccaataacagatattagggatgaaaag
cttcgacaacctccttccaaatctgtaccgtctagtgctactccgactagtagtgcatcg
gcgagttctgcacggactttgaaaaatcgaccagtacctccaccgacagcatcatcagtg
acaccgctatccagtactaactctggaagtgcgatgggatcactttcgaacaaattgcac
gggctgaagatcaatacggaccatctgccaacgtctggatcacagcagtcaacccaaagt
gcagattcgatgacttccaatctaatatccatgtacgatagcgaaccaacaacaagcagc
agcacaagcctggtaaaccatgggaaagaaagtgaaattatagagcacgatagagatgat
agcacagatgaacttgagtcagatatatggcaaacttacaagatccatgaacaaattgat
acgttgggaatattgggcgaaggaactggaggatcggtcacgaaatgtaagttaaggaac
ggttcaaaaatatttgcattgaagaccattgccacgatagagaatgatggctcagagaaa
caaatattcagagaattgcaattcaacaagagttgtaagtctgatttcatagtgaggtat
tacgggatgtttgcatgcgaagaaacctcgacaatttttattgcgatggaatatatgggc
ggaagatcgctagattcggtgtacaagcaccttctctctaaggggggacgaattggtgag
aaggttctggggaagatagctgagagcgtacttagaggactattttatctacacgaaaga
aagatcattcatagagatattaagccacagaacatattgttcaacgaaataggacaaata
aagctctgcgattttggagtcagtggagaggcagtgaactctcttgccaccacgtttaca
ggaacatcatactacatggctccagaaaggatacagggccagccatacagtgttaccagt
gatgtatggtctttgggtctcacactattggaagttgcacagggacactcaccatttgat
acggataaactagcagcaaacatgccccctatagaacttttgatgcttatcttgactttc
acacctgaattgaaagatgaaccagaacaaggcatagtatggtccaaatccttcaaatcg
ttccttgattacagtctgaaaaaagattcaaaggatagaccatctccaagacaaatgcta
caacacccctggatggtgggacaaaccaagaaacacgttaacatgaagaagtttattcaa
acttgttgggcggattga

DBGET integrated database retrieval system