KEGG   Kluyveromyces lactis: KLLA0D07458gHelp
Entry
KLLA0D07458g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kla  Kluyveromyces lactis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kla00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kla00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:639883..640581
Genome map
AA seq 232 aa AA seqDB search
MSCKPSVCCVVACLMPGYGIGYQGSLPWRLSKEMKYFRQLTSATRDSSMRNAVVMGRKTW
ESIPAKFRPLPNRLNVVVSRNCQLDINDEQTQFTKSRVGDDDDDDGGDDATLYAGDLSRA
IDQLIANSKILGLETIYIIGGGDIYRQCIPMSHNLFITKIVPDLGMPVPPMDTFLDREQI
ESQFKEQPHHKLQEIVPKEVSLPQFSADSSSAPTISEKGFTYSFTLWSRDTQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtaaaccttcagtgtgttgtgtggtagcatgcttgatgcctgggtatggtatt
gggtaccagggctctcttccctggagactatccaaagagatgaaatattttcgacagttg
acctccgctacaagggattcctcgatgcgtaacgctgtggtaatgggtagaaagacttgg
gaatcgattcctgcgaaatttcgaccattgccgaataggttgaacgtcgtggtctccagg
aattgccagctcgatatcaatgacgaacagacacaatttacaaagtcacgtgtcggtgat
gatgatgatgatgatggtggtgatgacgcgactctttacgcaggagatctttctcgagcc
atagaccaattgattgctaatagtaaaattctggggctggaaacgatatacattatcggt
ggtggtgatatatatcgtcagtgtatcccaatgtcgcataacttgtttattactaagatt
gtgcctgatttaggaatgcccgtcccacctatggatactttcctagatagagaacagatc
gaatctcaattcaaagagcagcctcaccacaagctacaggaaatagtgccgaaagaagta
tcgttaccgcagttctcggctgattccagttcagcaccaacgatatccgaaaagggtttc
acatattcttttactttatggtcacgtgatacacagtag

DBGET integrated database retrieval system