KEGG   Kluyveromyces lactis: KLLA0D08459gHelp
Entry
KLLA0D08459g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLLA0D08459g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0D08459g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(718046..720298)
Genome map
AA seq 750 aa AA seqDB search
MTDSVKPLVDRIVSQPLEFKKAVQEDSYNVGGEGSSYIMISSSTQKQQQEAKEGDEHQLE
HGHHQGIAATATASRKEKVVKPSSFAEALKMYTTKKSAANAAESKPNRSSQLPITASHVT
PSGKLSIGLSNELLLSDDDYHGSSTEDEEHPIVSLLENKVTPDSNEMSGSGSSSASSSSA
ATSAPVSSSDDDDEDEDEDEVFHEANEFVQPSLALAAPAEQPGNVDEDEDSDDSSFHASS
ASAEDEDDENDEDVSAEEKEELKLEATEHAAASSCQFKGVSSSSTAAASESKPEEEENGE
EEEEDEELKHKSPQPLSPTPPTTLQDKSSFYQFNESINDHGSNKPQRIVKNWGSKLTQLK
PRGLLNHGVTCYTNAAVQAMVHIPAIQHYLFQLLRGNFKDTVKSNCVSMLLAETTMRMWS
SDSTKNTYINPDKLINALEDINCMMSAWNQEDSHEYFMSLMSRLQEDSVPKGHKMTESII
YDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLHLKGRKTTDQDQNSVGQDNSIDNSVDQQ
QSSKRRFSIEKSIRDFFNPELIKRVDNKEGYTCEKCKKVTNALKSNKIIRAPETLVVHLK
KFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLPVRYQLISVVVHEGRSLSSGHYIAH
CKQPDGSWATYDDEYINKISEKQLLKEPNAYFLVYTRLTPKSVPLSSQSSNKSTDLGIPQ
LQRPPSSHSSSQNNSKRKNKKKNKKRRISP
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgactgattctgtaaaaccactagtggatcgtatcgtttcgcaaccgttggaattcaag
aaagctgttcaagaggactcatataacgtcggtggtgaaggctcttcgtatattatgatc
tcatcgagcacccagaaacagcagcaggaagccaaagaaggcgatgagcatcagttagag
catggacatcatcagggtatagctgctactgcaactgcgtcccgtaaggagaaggtggtc
aagccctcatcatttgcagaggcgttgaagatgtataccactaagaaaagtgcggcaaac
gctgcggaatctaagccaaacagaagttcgcaattaccaattaccgcttctcatgtgact
ccatcggggaaattatctatcggtttgagcaatgagcttttactcagtgatgatgactat
catggatcctcgactgaagatgaggagcatccaatcgtgtcgttgttggaaaacaaagtg
accccagattcaaacgaaatgtcgggttctgggtcttcttccgcttcttcatcatctgct
gcaacttctgctcctgtctcgtcgtctgatgacgacgatgaggatgaggatgaggatgaa
gtgtttcatgaggctaatgaattcgttcaaccatcgctggcattagctgctcctgctgag
cagcctggaaatgtcgatgaagatgaagatagtgatgacagttcattccacgcttcttct
gcatcagcagaagacgaggatgacgagaatgacgaggatgtttctgcagaggaaaaggaa
gaactcaaattggaggctactgaacatgctgctgcttcttcttgtcagttcaaaggagtg
tcttcatcttcaactgcggctgcttctgagagcaaacctgaagaagaggaaaatggcgaa
gaagaggaagaggatgaagaattgaagcacaaatctccacaacctctatcacctacccct
cctaccactcttcaggacaagtcaagcttctaccaatttaacgagtcgattaatgaccat
ggttctaataaaccacagaggatagttaagaattggggctctaagttgacccagctgaaa
ccaaggggtttactcaaccatggtgtcacatgttacacaaacgctgctgtgcaagccatg
gttcatattccagcaattcaacactatttatttcaattactacgtggaaatttcaaggac
accgttaagtctaactgtgtttccatgttattagcggaaactacgatgagaatgtggtct
tctgactcaactaaaaatacgtacattaatcctgataaattaatcaatgcgttggaagac
attaactgtatgatgagcgcttggaaccaagaggactctcacgaatattttatgtcttta
atgtcacgtttacaagaggactcggttcctaagggccataaaatgacagaatccatcatt
tacgatgtattcggtggattactacaacaatcagttaaatgcagtaactgtggtgagatt
tcaaccactgaacaacctatatacgatctttcattgcatttaaagggtagaaagacaact
gatcaagatcaaaactctgttggtcaagataattcaattgataactctgttgatcaacag
caatcttcaaagagaaggttttcaattgaaaaatctattcgggatttcttcaatcctgag
ttaatcaaaagagtggacaacaaagaagggtatacatgtgagaaatgtaagaaagttact
aacgcgctaaagtcaaacaagattattcgtgctccagagactctagtggttcatttaaaa
aagttcagatttaatggcacatcttcatccaaaatgaagcaggccgtatcttatccaatg
tttttagatctaacggaatactgccatgaatcaatcagctccttacccgtaagataccaa
ctaattagtgtcgttgtgcatgaagggcgatctttatctagcggtcattatatcgcacat
tgtaagcaaccagatggaagttgggccacatatgacgacgaatacatcaataaaatttca
gaaaaacagcttttgaaagagccaaacgcgtacttcttagtgtacactagacttacacca
aaatcggtcccactttcctctcaatcttccaataaatctactgatctaggtattccgcaa
ttgcaaagacctccatcttcacactcatcatcgcagaacaactctaaacgtaagaataag
aaaaaaaacaagaagagaaggatttccccataa

DBGET integrated database retrieval system