KEGG   Kluyveromyces lactis: KLLA0D08712gHelp
Entry
KLLA0D08712g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KLLA0D08712g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(739348..741447)
Genome map
AA seq 699 aa AA seqDB search
MPAGLDNLDFAVLCALALAVVAYFGRDTLKAVFSSDDSLTSVSSTSRDIVEVAKENDKNY
LVLFGSQTGTGEDYAKKFAKELIAKFQLKVMCVDVEKYDFDNLSQLPSNIPVSFFISTYG
EGDFPDGAVALEEFLRDAEADSLSNLKYTLFGLGNSTYEFFNGASKKTEKYLKDAGANLI
GKFGIADDGAGTTDEDYLSWKDATLDALKDVLHLDEHEEKFEPAYQYEELEQYYDESVSH
GEPTTAYLPENTIKGPFTHNQPFLAPVVKSRELFKNTDRNCIHAEFDLEGSNLKYTTGDH
LGVLPSNSDEHVKQFLTTFSLKEDTVFDLISTDATVQPPFPVPTSIGAAVRYYLEITGPV
SRSIFGQLVEFSPNEEVKAKLVQLSKDKEEFAKQITSKHFNLADAVLYLSNGKPWSSVPW
NFLLETLPHMQPRYYSISSSSSTEPGVVHVTAVVENQPNPTEEGKKITGVATNLLRNIQL
VQNKVDLYELEKNEKEGRTPTPSLSVHFDLNGPRNLYKNFKLPVHIRHSQFRLPSNPNTP
VIMIGPGTGVAPFRGFIRERVAYKEHHKDDGEAISQLGKHILFYGSRNQNDYLYAEEWPE
YAKKLGECFEMVVGHSRLGGDSKKRTYVQDLLIQRREDVFKMIKDGAFIYVCGDAKGMAQ
GVHKALVQIISEGNKVSEEDATNIIKMMKTTGKYQEDVW
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgccagctggtttagacaatttagattttgcagtgctttgtgcgcttgcattagctgtc
gttgcttatttcggtagggacaccttgaaagctgttttcagttctgatgattcgttaaca
agcgttagctcgacatctcgtgacatcgtcgaagttgcaaaggaaaacgataagaactac
cttgtgctatttgggtctcaaacaggtactggagaagattacgctaagaaatttgctaag
gaattgattgctaagttccaattgaaagttatgtgcgttgatgttgagaaatacgatttt
gacaatttgagccaactaccttccaacatcccggtgtctttcttcatttctacttacggt
gaaggtgacttcccagatggtgctgttgccttggaagagtttttgcgtgatgctgaagct
gattcgttgtctaatttaaaatacaccttgtttggtctaggtaactcaacttatgaattt
ttcaatggtgcttcaaagaagactgaaaaatatttgaaggacgccggtgctaatttgatc
ggtaagttcggtattgccgatgacggtgctggtaccaccgatgaagattatttgtcctgg
aaggatgctactttggacgctttgaaagacgtcttgcatctagatgaacacgaagagaag
tttgaacctgcctatcaatacgaggaattagaacaatactatgacgaatctgtgtcacat
ggtgaaccaactactgcgtacttaccagaaaatactattaagggcccattcacccataac
caaccattcttggcccctgtcgttaaatctagagaattattcaagaacactgaccgtaac
tgtattcatgccgaatttgatttggaaggttctaacctgaaatatactactggtgatcat
ctcggtgtgctgccatctaactccgatgaacatgttaagcagttcttgactacattcagt
ttgaaagaagataccgtcttcgatctaatttccactgatgctactgttcaaccaccgttc
ccagttccaaccagtattggtgctgctgtgagatattacttggaaattactggccctgtc
tcaagatctatctttggtcaattggttgaattttctccgaacgaggaagtcaaggccaaa
ttagttcagttgtccaaggacaaagaagaattcgctaaacaaatcacctcaaaacacttc
aacctagcagacgccgtgctatacctatcaaatggtaagccatggtcctctgtcccatgg
aactttttgttggaaaccttgccacatatgcaaccacgttactactctatctcatcttcc
agtagtacagaaccaggtgttgttcatgttaccgctgttgttgaaaaccaacctaatcca
actgaagaaggtaagaagatcactggtgtcgccaccaatttattgagaaacatccaactt
gttcaaaataaggtagacctctatgaactagaaaagaacgaaaaggaaggtaggactcca
acgccgtcattatcagttcactttgatttaaacggcccacgtaacttgtacaaaaatttc
aagttgccagttcatatacgtcattcacaatttagactaccatcgaacccaaatacgcct
gtcatcatgatcggtcctggtactggtgtggccccattccgtggatttattagagaaagg
gttgcatacaaggaacaccacaaagatgacggggaagccattagtcaattgggtaagcac
attttgttctatggttctagaaatcaaaatgactacctttacgccgaagaatggccagaa
tatgccaagaaattgggcgaatgtttcgaaatggtcgttggtcattctagattgggtggt
gattcaaagaagagaacatatgtccaagatttattgatccaaagaagagaagatgtattc
aaaatgatcaaggatggtgccttcatctacgtctgtggtgacgctaagggtatggcccaa
ggtgtgcataaggcattagttcaaatcatctctgaaggtaacaaggtttccgaagaagac
gccacaaatattatcaagatgatgaagactactggaaaataccaagaagatgtttggtaa

DBGET integrated database retrieval system