KEGG   Kluyveromyces lactis: KLLA0D14014gHelp
Entry
KLLA0D14014g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
kla  Kluyveromyces lactis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:kla04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1200970..1203090)
Genome map
AA seq 706 aa AA seqDB search
MVSHLWLLQYLILSIPLVLGAPPRANPNQGNAADPESKLPSPLTEANFDETIAKNLHIIE
FFSPYCHHCKQLAPIWEKTYNGFYDESLQLNISLHQVDCIESGDLCMKEGINSYPTIRLY
GPEGFIKAFPRGLERTETTLLNFARKEALDADNLDITKLSSKSKLLNDGELLKILSEPQT
EPYFVSFWPTSDFEDIESSYQFKNCEDCSLFQRIWKLVSNKADSIGINTVHFNCVNPTDS
SKNEAICRELSFDTLTQKRNSRLERAPEFALILPNRKSGSFIKFPFGPKRVDSESLIDFA
TRTLHNSNVPNIDQDEIEAFVKEPKSDILEANAEADKILLVFNYNPETVVPEDMQFLEQL
IDPLGYIPNIYLYKNTDDLKKLSHTLYQTLYKDYNTDQRTEINEDHFITTSITQSPTFFI
FKKSTFTPIIFPGYSTTETRNLDFILDWLTINSLPTVTEITSKNFEALKGFEQDFYDKLV
IQLVNKKNNKFEEGSKKIVEGLRVAAHSYEILRNEAVYEGLKTAREEKKKLVQKLKNKNA
PSVDIVTAMRKEINYSYNHKVIFAYLDINESPSLLNNKGLNVYFRKFKTGDIIVVDKQKA
IYYEKDASGQYITLETLPEVLSILNFPARHPDLRIERIFLRTPLSGLLRLIDYLREFSGI
NYLFVVVTFLALWKIPRTIHHYKLKRRYAAKRDTHGILGKEAKLMD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcacttgtggcttttgcaatacttgattctttcgataccattggttttaggt
gcaccaccaagagctaatcctaatcaaggtaatgctgcggatccagaaagtaaattaccg
tctccattgactgaagccaactttgacgagaccatagcaaagaatctacacatcatcgaa
tttttcagtccatattgccatcattgtaagcagctagccccaatttgggaaaagacgtac
aatggcttttacgatgaatccttgcagctcaacatatctctccatcaagtggattgtatc
gagtcaggagacttatgtatgaaagagggtattaattcataccctaccatcagattatat
ggaccagaaggctttatcaaggcatttcccagaggtttggaacggactgaaacaactttg
ctaaattttgcaagaaaggaagctctggatgcagacaatctggatatcactaaactatcg
agcaagagtaaactgttgaatgatggtgagctcttgaagattttatcagaacctcaaact
gaaccatactttgtctcattttggccaacctctgattttgaagatatcgaatcttcttat
cagttcaaaaactgtgaagactgttcgctttttcaacggatttggaagttggtaagtaac
aaggctgactcgataggaatcaatacggtacatttcaactgtgtgaatccgacagattct
tcaaagaatgaagccatttgtagggagttgtccttcgatactttgactcagaagagaaac
tctaggttagaaagagccccggaatttgcattgatcttacctaaccgcaagagtggtagt
tttattaagttcccatttggtccaaagcgtgtcgatagcgaatccttgattgattttgct
acaagaactttacacaacagtaacgttccaaatattgatcaggatgagatcgaagctttt
gtaaaagaaccaaaaagtgacattttggaagcaaatgccgaagccgataaaatattgctt
gtatttaattataacccggaaactgttgtccctgaggatatgcaatttttggaacaactc
attgacccattgggatacatccctaatatttacttgtacaagaacactgacgacctaaag
aagttaagccatactctctatcaaactctgtacaaagattataataccgatcaacgcact
gaaattaatgaggaccattttatcacgacatccattacccaatcaccaacgttcttcata
ttcaagaaatctacgtttactccgatcatattccctggatattcaacaactgaaaccaga
aatttggacttcatcttggattggctcactataaactctcttccaactgtcactgagatt
acatccaaaaactttgaagcattaaaaggatttgaacaagatttctatgacaagttggta
attcaattggttaataagaagaataataagtttgaagaaggttcaaagaaaatcgtcgaa
ggcctacgagtagcggcacatagttatgaaatattgcgtaacgaggcggtgtacgaaggt
cttaagacggccagagaagaaaagaaaaaactggtgcaaaagcttaagaacaaaaacgca
ccatccgttgatatagtcactgccatgagaaaagagataaattacagttataatcacaag
gtcatatttgcctatttggacattaatgaatccccttctctcttgaataataaaggtcta
aatgtttacttcaggaagttcaagactggtgatatcattgtcgtggacaagcaaaaagcc
atctattacgaaaaggatgcttctggacaatacatcaccctagagacgttgcccgaagtc
ctctccattctgaatttccccgcaagacaccctgatcttcgtattgaacgcatctttttg
agaactccactcagtggattgctcagattaattgactacctccgcgaatttagcggaatc
aattacttatttgttgtggtgacattcttggcgttatggaaaatacccagaaccattcat
cattataaactgaaaagacgttacgctgcaaaacgggatactcatggtatcctcgggaag
gaagctaagctcatggattga

DBGET integrated database retrieval system