KEGG   Kluyveromyces lactis: KLLA0D16500gHelp
Entry
KLLA0D16500g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
kla  Kluyveromyces lactis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLLA0D16500g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     KLLA0D16500g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1392680..1394293
Genome map
AA seq 537 aa AA seqDB search
MIDLRPTRSIEKGDATYIRSRSHSKTRKPSLPRRNSSSRSIKTIPIELEKEGPATPQSLV
LGESISVPYVKSTLDISLPHDLLQEDFKNLIIALRVKHWYKHDLDASMLRFTRISGAMTN
AIFKVEYDNLPSLLVRVYGPNVESVIDREYELQVLARLSIQHIGPSLYGCFENGRIEQFL
ENSHTLTKSDIRDWKTSQRIARRMKELHSGVPLLSKELKDEPATWKRIEKWTNTLAKSSW
IQDNDNINKYLMVSSWDQFLSIVAKYKKWLQQKPSYRKLVFCHNDAQYGNLLFAAPVIPV
TADSEISQSVSNLSISESNSSLFPSSSHVSLEEIINPSIQEQAQDAKLVVIDFEYGGPNP
PAFDLANHLSEWMHDYNCSTPYVVFHDRFPTHEEMLNFIYSYLSHLNPKRKHMEEEVCEL
YNDILDWRGSVSLHWALWGIIQSGELTTEIDESEKTEEGPGGEKYIITVDKLSSPTIDGD
DSGEEENAGVDIDTFEYLLYSKNKLEIFYSDLIQLNVIDKSEVLNADDLKVIKMRRL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgattgacttacgtcctactcgttctattgaaaaaggggatgctacctatattcgctcg
agatctcatagtaaaactagaaaaccttcactgccacggaggaattcttcctccagatct
atcaagaccattccaattgaattagagaaagaagggccagctacgccacaatctcttgtt
ttaggcgaaagtatctcagtaccatatgttaaaagtaccttggacatatcacttccacat
gatctattgcaagaagattttaaaaacttgatcatagctctccgtgtcaaacattggtat
aaacatgatcttgatgccagcatgttaagatttacaagaataagtggtgcgatgaccaac
gctatattcaaagtagagtacgataatctgccatctttgcttgtccgagtgtacggtcct
aatgttgaatctgtcattgacagggaatacgagttacaagtgttggcaagattgtcaatt
cagcatatcggaccttcgttgtatggctgtttcgaaaatggtagaattgagcagttcttg
gagaactcgcatacgttgaccaaatcagacattagagattggaaaacttcgcagcgtatt
gctagaagaatgaaagagttacattcgggtgtaccgttgctctcgaaagaattgaaggat
gagcctgctacatggaaacgcatagaaaaatggacgaatactttagctaagagttcttgg
atccaagacaacgataacatcaataaataccttatggtatcaagttgggaccagttttta
tcaattgtagcgaagtacaagaaatggttacaacaaaagccttcgtataggaaactagtc
ttttgtcataatgatgcacaatacggtaatcttctttttgctgccccagttatacccgtt
acagcagactcggaaatttcacaatcagtctcaaacttatcaatatctgagtcgaactca
tctttattcccatcatctagtcatgtctctttggaagaaatcataaatccatcaattcaa
gaacaggcgcaagacgccaaattggtggttattgactttgaatacggtggacctaaccca
cctgcttttgacttggccaatcacctatccgagtggatgcatgattataactgttctacc
ccatatgttgttttccatgaccggttcccaactcacgaagaaatgctaaatttcatctac
tcttatttatcacatttgaatcctaagaggaaacatatggaggaagaagtatgtgaacta
tataacgacattttagattggagagggagtgtttctttacattgggcattatgggggatt
atccaatctggtgaactgactactgaaatagacgaaagtgaaaagacagaagaaggtcct
ggaggtgagaaatatattattactgttgacaagttatcctctcctaccatcgatggtgat
gactcaggcgaagaggaaaatgcaggtgttgatattgatacttttgagtacctattatat
tctaagaacaagctggagatcttctattcagatctcatccaactcaatgtcattgataaa
agcgaagttttgaatgctgatgatctcaaggtgataaaaatgagacgcttgtaa

DBGET integrated database retrieval system