KEGG   Kluyveromyces lactis: KLLA0D16500gHelp
Entry
KLLA0D16500g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
kla  Kluyveromyces lactis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kla00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1392680..1394293
Genome map
AA seq 537 aa AA seqDB search
MIDLRPTRSIEKGDATYIRSRSHSKTRKPSLPRRNSSSRSIKTIPIELEKEGPATPQSLV
LGESISVPYVKSTLDISLPHDLLQEDFKNLIIALRVKHWYKHDLDASMLRFTRISGAMTN
AIFKVEYDNLPSLLVRVYGPNVESVIDREYELQVLARLSIQHIGPSLYGCFENGRIEQFL
ENSHTLTKSDIRDWKTSQRIARRMKELHSGVPLLSKELKDEPATWKRIEKWTNTLAKSSW
IQDNDNINKYLMVSSWDQFLSIVAKYKKWLQQKPSYRKLVFCHNDAQYGNLLFAAPVIPV
TADSEISQSVSNLSISESNSSLFPSSSHVSLEEIINPSIQEQAQDAKLVVIDFEYGGPNP
PAFDLANHLSEWMHDYNCSTPYVVFHDRFPTHEEMLNFIYSYLSHLNPKRKHMEEEVCEL
YNDILDWRGSVSLHWALWGIIQSGELTTEIDESEKTEEGPGGEKYIITVDKLSSPTIDGD
DSGEEENAGVDIDTFEYLLYSKNKLEIFYSDLIQLNVIDKSEVLNADDLKVIKMRRL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgattgacttacgtcctactcgttctattgaaaaaggggatgctacctatattcgctcg
agatctcatagtaaaactagaaaaccttcactgccacggaggaattcttcctccagatct
atcaagaccattccaattgaattagagaaagaagggccagctacgccacaatctcttgtt
ttaggcgaaagtatctcagtaccatatgttaaaagtaccttggacatatcacttccacat
gatctattgcaagaagattttaaaaacttgatcatagctctccgtgtcaaacattggtat
aaacatgatcttgatgccagcatgttaagatttacaagaataagtggtgcgatgaccaac
gctatattcaaagtagagtacgataatctgccatctttgcttgtccgagtgtacggtcct
aatgttgaatctgtcattgacagggaatacgagttacaagtgttggcaagattgtcaatt
cagcatatcggaccttcgttgtatggctgtttcgaaaatggtagaattgagcagttcttg
gagaactcgcatacgttgaccaaatcagacattagagattggaaaacttcgcagcgtatt
gctagaagaatgaaagagttacattcgggtgtaccgttgctctcgaaagaattgaaggat
gagcctgctacatggaaacgcatagaaaaatggacgaatactttagctaagagttcttgg
atccaagacaacgataacatcaataaataccttatggtatcaagttgggaccagttttta
tcaattgtagcgaagtacaagaaatggttacaacaaaagccttcgtataggaaactagtc
ttttgtcataatgatgcacaatacggtaatcttctttttgctgccccagttatacccgtt
acagcagactcggaaatttcacaatcagtctcaaacttatcaatatctgagtcgaactca
tctttattcccatcatctagtcatgtctctttggaagaaatcataaatccatcaattcaa
gaacaggcgcaagacgccaaattggtggttattgactttgaatacggtggacctaaccca
cctgcttttgacttggccaatcacctatccgagtggatgcatgattataactgttctacc
ccatatgttgttttccatgaccggttcccaactcacgaagaaatgctaaatttcatctac
tcttatttatcacatttgaatcctaagaggaaacatatggaggaagaagtatgtgaacta
tataacgacattttagattggagagggagtgtttctttacattgggcattatgggggatt
atccaatctggtgaactgactactgaaatagacgaaagtgaaaagacagaagaaggtcct
ggaggtgagaaatatattattactgttgacaagttatcctctcctaccatcgatggtgat
gactcaggcgaagaggaaaatgcaggtgttgatattgatacttttgagtacctattatat
tctaagaacaagctggagatcttctattcagatctcatccaactcaatgtcattgataaa
agcgaagttttgaatgctgatgatctcaaggtgataaaaatgagacgcttgtaa

DBGET integrated database retrieval system