KEGG   Kluyveromyces lactis: KLLA0D16522gHelp
Entry
KLLA0D16522g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kla  Kluyveromyces lactis
Pathway
kla00020  Citrate cycle (TCA cycle)
kla00310  Lysine degradation
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
Module
kla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLLA0D16522g
  Amino acid metabolism
   00310 Lysine degradation
    KLLA0D16522g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KLLA0D16522g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-GeneID: 2893167
NCBI-ProteinID: XP_453789
UniProt: Q6CQK0
Position
D:complement(1394850..1396256)
Genome map
AA seq 468 aa AA seqDB search
MLRSSTRVAVKSALHKPLVRCATVSQLEAVRSFSSSRISSDISSRNGSFNAVSRRSSGPF
QFRCSPSQLNTRFMAVRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDK
IDVEVISPISGTIAKLNFSPDDTVTVGEEIAQIEPGEAPAGGAAASESSSASAPAAEEQQ
QQAAPKKEEQPATPKKEEKAAAPAPKKEEKPAAAAPKKTEVDSSATESSTPSFTQFSRNE
HKVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSAVLEMRKLYKDEIIKTKNVKFGFMG
LFSKACTLAAKDIPAVNGAISGDQILYRDYTDISIAVATPKGLVTPVVRNAESLSVLEIE
QEIVRLGKKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGVKERPV
TVNGQIVSRPMMYLALTYDHRLLDGREAVTFLRTVKELIEDPRKMLLA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggagttctactagagttgcagttaaatctgctttgcacaagcctttggttcgt
tgtgctactgtttcacaattagaagcggttagaagttttagttcaagccgaatttcttcc
gatatctcttcaagaaatggatcttttaacgccgtgagtcgtcgttcttctggtccattc
caattccgttgttccccttctcagttgaacactagattcatggcagttcgtcatgctact
tctgtgccggttcctcctatggctgaatcgttgactgaaggttctttgaaggaatacact
aagaaagtcggagatttcatcgaaaaggacgaactgttggctactatcgaaaccgataag
atcgacgtcgaagtcatttctcctatctccggtaccattgcgaagttgaacttctctcca
gatgatactgttaccgttggtgaagagattgctcaaattgagccaggtgaagctcctgct
ggcggtgctgccgcttcagagtcctcttccgcttctgcacctgctgctgaagaacagcaa
caacaggctgctcctaagaaggaagagcaaccagccactccaaagaaggaagaaaaggcc
gctgctccagctccaaagaaggaggaaaaaccagccgctgctgctccaaagaagactgaa
gttgactcatctgctactgaatcctctaccccatctttcactcaattctcccgtaacgaa
cataaggtcaagatgaaccgtatgagaatgagaatcgctgaaagattaaaggaatctcaa
aacactgctgcttctttgaccactttcaacgaagttgacatgtccgctgtcttggaaatg
agaaaattatacaaagatgaaatcatcaagactaagaacgttaaattcggtttcatgggt
cttttctctaaggcttgtactttggccgctaaggatattccagctgtaaatggtgctatc
tccggagatcaaatcctttaccgtgattacaccgatatctctatcgctgtcgctactcca
aagggtttggttaccccagtggttcgtaacgctgaatcattgtctgttttagaaattgaa
caagaaattgtcagattgggtaagaaggccagagatggtaagttgactttggaagatatg
gctggtggtactttcaccatctctaacggtggtgtcttcggttcattgtacggtacccca
atcattaacatgccacaaacggctgttttaggtttgcacggtgttaaggaaagacctgtc
actgttaatggtcaaatcgtctctagaccaatgatgtacttggctttgacttatgaccat
aggttgttggatggtagagaggctgttactttcttgagaactgtcaaggaattgattgaa
gatccaagaaagatgcttttggcttaa

DBGET integrated database retrieval system