KEGG   Kluyveromyces lactis: KLLA0D16522gHelp
Entry
KLLA0D16522g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kla  Kluyveromyces lactis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0D16522g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLLA0D16522g
  Amino acid metabolism
   00310 Lysine degradation
    KLLA0D16522g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KLLA0D16522g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1394850..1396256)
Genome map
AA seq 468 aa AA seqDB search
MLRSSTRVAVKSALHKPLVRCATVSQLEAVRSFSSSRISSDISSRNGSFNAVSRRSSGPF
QFRCSPSQLNTRFMAVRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDK
IDVEVISPISGTIAKLNFSPDDTVTVGEEIAQIEPGEAPAGGAAASESSSASAPAAEEQQ
QQAAPKKEEQPATPKKEEKAAAPAPKKEEKPAAAAPKKTEVDSSATESSTPSFTQFSRNE
HKVKMNRMRMRIAERLKESQNTAASLTTFNEVDMSAVLEMRKLYKDEIIKTKNVKFGFMG
LFSKACTLAAKDIPAVNGAISGDQILYRDYTDISIAVATPKGLVTPVVRNAESLSVLEIE
QEIVRLGKKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGVKERPV
TVNGQIVSRPMMYLALTYDHRLLDGREAVTFLRTVKELIEDPRKMLLA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggagttctactagagttgcagttaaatctgctttgcacaagcctttggttcgt
tgtgctactgtttcacaattagaagcggttagaagttttagttcaagccgaatttcttcc
gatatctcttcaagaaatggatcttttaacgccgtgagtcgtcgttcttctggtccattc
caattccgttgttccccttctcagttgaacactagattcatggcagttcgtcatgctact
tctgtgccggttcctcctatggctgaatcgttgactgaaggttctttgaaggaatacact
aagaaagtcggagatttcatcgaaaaggacgaactgttggctactatcgaaaccgataag
atcgacgtcgaagtcatttctcctatctccggtaccattgcgaagttgaacttctctcca
gatgatactgttaccgttggtgaagagattgctcaaattgagccaggtgaagctcctgct
ggcggtgctgccgcttcagagtcctcttccgcttctgcacctgctgctgaagaacagcaa
caacaggctgctcctaagaaggaagagcaaccagccactccaaagaaggaagaaaaggcc
gctgctccagctccaaagaaggaggaaaaaccagccgctgctgctccaaagaagactgaa
gttgactcatctgctactgaatcctctaccccatctttcactcaattctcccgtaacgaa
cataaggtcaagatgaaccgtatgagaatgagaatcgctgaaagattaaaggaatctcaa
aacactgctgcttctttgaccactttcaacgaagttgacatgtccgctgtcttggaaatg
agaaaattatacaaagatgaaatcatcaagactaagaacgttaaattcggtttcatgggt
cttttctctaaggcttgtactttggccgctaaggatattccagctgtaaatggtgctatc
tccggagatcaaatcctttaccgtgattacaccgatatctctatcgctgtcgctactcca
aagggtttggttaccccagtggttcgtaacgctgaatcattgtctgttttagaaattgaa
caagaaattgtcagattgggtaagaaggccagagatggtaagttgactttggaagatatg
gctggtggtactttcaccatctctaacggtggtgtcttcggttcattgtacggtacccca
atcattaacatgccacaaacggctgttttaggtttgcacggtgttaaggaaagacctgtc
actgttaatggtcaaatcgtctctagaccaatgatgtacttggctttgacttatgaccat
aggttgttggatggtagagaggctgttactttcttgagaactgtcaaggaattgattgaa
gatccaagaaagatgcttttggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system