KEGG   Kluyveromyces lactis: KLLA0E00595gHelp
Entry
KLLA0E00595g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kla  Kluyveromyces lactis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KLLA0E00595g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KLLA0E00595g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLLA0E00595g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(49243..51228)
Genome map
AA seq 661 aa AA seqDB search
MTEKELVIKSDTEKEVVPLVAAIDVGTTSSRVILFNRLGQEISKHQIEYSTSASHSAYSA
SGERRLEENKTNGSSNEQTIFSAEGIAIEATEYLEIEDLEKDVEPTLRFPKPGWVECKPM
NILENVVQCFAANLITMDRVNGDRVSNGLPPYRIKCIGIANMRETTLVWSKKTGKPLIDY
GIVWNDVRTTEIVQKKKDETPEEYQEHLRELTGLPLFSTYFSCSKLRWLLDNIPEVTKAY
EENDLVFGTVDTWLIANLTHNNVLVTDVTNACRTGFMNLNTKDYDDELLDYWNIDKAKIH
LPKIVSSSEYYGNFVVPECTKKSLTSTAWDLLSAFSQRVPPVPIQGCLGDQSASLVGQLA
FKPGSAKCTYGTGCFLLYNTGTTKLISKHGALTTFAYWFPQLENEENDYGKPHYALEGSV
AVAGAVVQWLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPYWDPDARATIMG
MSQYTTASHIARAAVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDETYEKTLLSTLAV
DGGMSRSDEVMQIQADILGPCVKVRRSPTSECTALGAAIAAAMAFKTDEERILWKNLKDV
KKWVFYGGVEKGEKAPPSTTNDTDLKVFISKSSDKSRRKGWKMWETAIEKSKGWMNEIQL
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaagagttagttattaagtccgatacagaaaaagaggtggttccgttagtt
gctgctattgatgtcggtaccacatcttcacgtgtgattcttttcaacagattgggacaa
gaaatttccaagcatcagatcgagtacagtactagtgcttctcattccgcatattctgca
agcggtgaacgaagattggaagagaataagaccaatggttccagtaacgaacaaaccatc
ttcagcgcggaaggtattgctattgaggccacggagtatcttgagatcgaggatctagaa
aaagatgtagaacctacgttaaggttcccaaaaccgggatgggtcgaatgtaaaccaatg
aacattttggaaaacgtggttcaatgtttcgcagcaaacttgattacaatggatcgcgta
aacggcgatagagtctctaatggtctaccgccttatcgcatcaagtgcataggtattgct
aacatgagagaaacaactttagtatggtcaaagaagaccgggaaacctttaatcgattac
ggtattgtatggaacgatgttagaaccacagagatagttcaaaagaaaaaagatgagaca
ccagaagagtaccaagaacatttaagggaattaactggattaccattgttctctacatat
ttctcctgttccaaacttcgctggttattagataatatccctgaagttaccaaagcttac
gaagaaaatgatttggtcttcggcactgtcgacacctggttgattgccaatttgacccac
aacaatgttttagttaccgatgtcactaatgcttgcaggacagggttcatgaatttaaat
actaaggattacgacgatgaattgctcgattattggaacatcgacaaggcaaagattcat
ttgccaaagattgtttcaagttctgagtactacggtaattttgtagttccagaatgtacc
aagaaatctttgacgtccacagcatgggatcttctatcagcattttcgcaaagagttcct
ccagtgccaatacaaggttgtcttggtgaccaaagcgcatctttggtgggtcagcttgca
ttcaaaccaggctctgccaaatgtacttacggtacaggttgtttccttttgtataacaca
ggaactactaaattgatatcaaagcacggtgcgctaacaacatttgcatactggttccca
cagttagaaaatgaagaaaacgattatggtaaaccacattatgccttagaaggttcagtt
gctgttgctggtgccgtagttcagtggctaagagacaacttaagattgattccaagagct
gaagatgttggacctctagcatcagctgtaccaaattccggtggtgttgtgtttgtaccg
gctttcagtggtttatttgcgccatactgggatcctgatgctcgtgcaactattatggga
atgtcacaatacacaacagcttctcacatcgctcgagctgctgtcgagggtgtctgcttc
caagcgagggctattttaaaagccatgagttctgatgctttcggctcagaagataaggac
tttttagaagaagttgttgatgaaacttacgagaaaactttactttcgactttagctgtt
gacggtggtatgtctagatcagatgaagtgatgcaaattcaagctgatatcctaggcccc
tgtgtcaaggtaagaagatctccaacttcagaatgtactgctttaggtgctgcaattgcc
gctgctatggctttcaaaacagatgaagaacgtattttatggaagaatctaaaggacgtc
aaaaaatgggtattctatggaggggtagagaaaggcgagaaagctcccccaagtaccacc
aatgacacggatctgaaggtctttataagcaagtcttcggacaaaagtagaagaaaaggt
tggaagatgtgggagactgcaattgagaaatctaaaggatggatgaatgaaattcaattg
tcataa

DBGET integrated database retrieval system