KEGG   Kluyveromyces lactis: KLLA0E02289gHelp
Entry
KLLA0E02289g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
kla  Kluyveromyces lactis
Brite
Exosome [BR:kla04147]
 Exosomal proteins
  Proteins found in most exosomes
   KLLA0E02289g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(212983..213350,213571..213583))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG
LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcatacactgataacttattggccaccggtaagattgacaaatctgtc
atttactccagagcaggtgatgcagtttgggcctcatctggtggtttgcaattacaaccg
gctgaaatctctgaaattgctagaggttttgacaatccatctggactacaatccaacggg
ttacacgttcaaggccaaaagttcatgttgatcaaggcagatgacaggtccatttacggt
agacatgaagccgaaggtattgtcattgttagaacaaagcaaacaattctaatcggacac
tatccaccaggtgttcaagcaggtgaagctaccaagatcgttgaacagttgggtgactat
ttgatcagtgttcaatactga

DBGET integrated database retrieval system