KEGG   Kluyveromyces lactis: KLLA0E02377gHelp
Entry
KLLA0E02377g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLLA0E02377g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0E02377g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(218647..222309)
Genome map
AA seq 1220 aa AA seqDB search
MMASQEPALELNGEQRDSVSETAEVLRSKSLESFSDLVDDGKTLLYGDISKSFPFKTCDR
ILDDIRISPWFLKKFGSSVMKQPMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCP
GKNTISVMFALLVDPNFTPNDFDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVL
EPESLHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKLILVEIIKPEFNSENLAEYRTAKI
EERYKNACQEFDLLNPDDIPSQAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQI
NTDWLTTMFDFSLQKTAVEDNVQSGEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIG
KQSMLLENELGTEKKTVAKCFSNQHFSASHTWWFNILNHQHIEPFPYDINYHFINLSVAF
KYIDKDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNAL
QVFGLDPTDIDASLLDANTMIEYYNSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVE
YEPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLL
NVLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLK
LKMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIK
PLRDFILNYDDDSAKLLDASEYHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNS
RCVTPTKELVYLAFAPSNVEVEFGDDTVAQKELIDLTTDVVEDPTDTTRHLASCDDDIIM
CQSPVALPEHKTSSEAGTQQYSVQVAKISADQLENTLEIGRQQDVTECIGNVLAQLEIAS
EPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGDHPKDIYDA
LDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIEPLPFGETL
YMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLIETKKFLQS
GTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEFKHIGYSLF
AVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATPYFLVYV
REGQEQETIEPLKRILQQQE
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcacaagaaccagctttagaattgaatggcgaacagagagattctgtttcg
gaaacagcagaagtactgagatctaagtcgttggaatcattttcagatttagtagacgat
ggtaagacgcttttgtacggagatatttcgaaaagttttccgttcaaaacatgcgatcga
attttagatgacattaggatttcaccatggttcttgaagaagtttggttcatctgtgatg
aaacaaccaatgcttcagtactcgagggaaagacagcaattgcaaccgtggaacctagtg
catttaattgaccaggttaatttgagaagcagatatgattatgattcaatgacttgtcca
gggaagaataccatcagtgttatgttcgcattgctggtagatccgaattttactcctaat
gactttgatgacattgacaagtttcctgaatacttctttcatttgaagattactgtgaaa
aggagatcatacttggaaaatttcaatagacacgttgggataactcattatcatgtttta
gagcctgaatctttacatccattcgacaaaagggatatctttataatggaagagaaagac
tgtagattagtagaccaaagtatatttgtttctgctgatactaataaacttatacttgtt
gagataataaaaccagaatttaattcagagaacctagctgaatatcgaacagcaaaaatt
gaggaaagatataaaaatgcatgtcaagaatttgatttattgaacccggacgatattcct
agccaagccgagtgtttgaaaactcttttcatgatatttaagaacccattacagaggaaa
tctgctaatagtgagtttaagattatttccagggatagtgttgcactcaactcacaaatt
aatactgactggttaacgacaatgtttgatttcagtttgcagaagaccgctgtagaagat
aatgtccaatctggagaggaatataagccaccagatttagttgattatatcacagatttt
aaggtcagagggattagagaggcgtataccagaaaatccatggaggttgttttaattggt
aagcagtcgatgctacttgaaaatgaacttggtactgaaaagaagacagtggcaaagtgc
ttttctaatcaacattttagtgccagtcacacatggtggttcaatattttgaaccaccaa
cacattgaaccattcccctacgacataaattaccattttattaacctatctgttgctttt
aagtacatcgataaggatatcattaaaaactatgaaactcaaattgcacttgatcaggaa
aacatcagccattattttgatgctctccaatatgtaacaaacgcaaagggtagttaccag
cttattgcttactgtggaaaacaagatgttgttgggtatgaagatttgaataatgcatta
caggtatttggtttagatccaactgacattgacgcaagcctccttgatgccaatacgatg
attgaatattacaattctcatctattaaggagctctgataatcaaagaaaagatctaaga
aatgccctacgtgtgctaggaaaatatttaggtagtcaaaagatgttgtttttggtggag
tatgaaccatattataatgtacaacaagcttacactcttttaaaggtagacgagacagta
gatgatgatattatccaaactgcatatacgatcaatattgctgatgcccctggtttgaaa
aaagattatgatcgggcgatttttacaatagcactagataggcgctcaatatttcttttg
aatgtcttgacagatgaatgtccagaatttgcgcaatattacaactgcactgacatatca
tacgatgaagcattgaacatcattgaaattgacatgaatgcaagcgacgatgtcatcctt
gaagtttttcaaaagaaatggagtcacggaattatgacaggtcctgattatctattgaag
ttgaaaatggcccttcagaatattggttttactagaaatagtaaacttatcaaccacttt
ttagacaccggtattgtggacgtaagttgtcttcctgttgctacatggccagctggaatc
aataatgtgggaaatacatgctacctaaactcactacttcaattctttttcactatcaaa
cctctacgtgattttattttgaattatgatgatgactctgctaaattactggatgcgtct
gaatatcactctagaagaagaattggaggcagggaggtcagcaaacaagaagagcttaga
tcggtccagtttgtctaccatcttcgtgatttgttcaatgacatgatccacacaaacagt
agatgcgtcacgcccacaaaagagttggtctacttagcctttgctccgagtaatgtcgag
gtggagttcggtgacgatactgttgcccagaaagaactcatcgacttaacaactgacgtc
gtcgaagaccccactgatactactcgtcacctagcgtcttgtgatgatgatatcataatg
tgccagagcccggttgcgctccccgaacataaaacatcgtcagaagcaggaacacagcaa
tattccgtccaagttgctaaaatcagtgcggaccaacttgaaaatacattggagatcgga
agacaacaagatgttacagaatgtataggtaacgtcttggctcagcttgagattgcttca
gaacctttgagcttggaagacgacttggaacagaatgatcttgtcaaacagttgttttac
ggtagaattaaacaggacttgataccagtcaatgatgaggcttctgtccggacaaaatat
gaaaggtttttatccttattggttaacaccggtgaccatccaaaggatatttatgatgct
ttagatttttactttcagaatgactatttgaatttggaggagtatggtgatgtaaagaga
actgtatctatctcagagttacctgcggttctacaaattcaaatccagagagtctattat
gatagagaaaaattcatgcctttcaagtctatcgagccgctacctttcggcgaaacgttg
tacatggatagatatatggctaccgaggatccaaaactattagcagaaattcaacaaaac
gcagaattgaaacagaaacttcaagacttaaagcaaagacagaggaaactactctcacag
aacgaaataggattaactttaaaatcctcgctcattgagaccaaaaagttcttacagtcc
ggtaccttgaaagcgcacgatattgatgcggacaatatcccctcatcgatcgcctacatt
gatattttaatcaataacatagacgaggaactaaagagcttattcaacaaaattacagat
ctagagacaactatttcccaacagttcagcgaattcaaacatatcggctattctttattc
gccgttttcattcatcgtggtgaagcaagttacggccattactgggtctatattaaagat
cacaccaaaaatggtatctggaggaagtataatgatgactcagttacagaggtgccacaa
tcggaagtattcaacttcacggagggtaatacggccactccatactttttggtctacgtc
cgtgaaggtcaagaacaagaaactatcgaaccattgaaacgaattcttcaacaacaggag
taa

DBGET integrated database retrieval system