KEGG   Kluyveromyces lactis: KLLA0E06689gHelp
Entry
KLLA0E06689g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
kla  Kluyveromyces lactis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    KLLA0E06689g
  Replication and repair
   03420 Nucleotide excision repair
    KLLA0E06689g
Transcription machinery [BR:kla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     KLLA0E06689g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:605566..606762
Genome map
AA seq 398 aa AA seqDB search
MLKGSDYSSAVGSSITESRMPNMSAENSTVEPTPVPEPTPTTETKKAESKRITDDDLYRH
SSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDIISKHNDLSQEELNAINEKAVPVTM
EEELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFLVNSTMEIHPKHILLASIFLA
CKSENYFIGIEAFAKKTKSQPTTILKYEFDVLESLQFTLLNHHPYRPLHGFFLDIQYILH
GKVDLNYMGQIYTNCKRRITETLLTDVVYHYTPPQITLACLLIDDEALTLKYLEVKFGSP
PEEQKDSETEGLKTEETPSDTKLPSNLKLQTLTALIRECQAMILNVETLSKEEATKIDAK
LHYCQNPMLLVDRMRRQKQQRDSSAELTTEPDSKKLKV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaagtgactattcctcagcagtaggctcctctattactgagtctcgtatg
ccgaacatgtctgcggagaattctacggtagaacccactcctgtacctgaacccactcct
acaacagagacaaagaaagctgaatctaagagaattactgatgatgacctatacagacac
tcatcgcaatatagattatggtcatttacaaaggaacagttagagagcagaaggcgagct
ttgaatgccaaagtcgtagataaggtaaatgaaaaactacaagatatcatttcgaaacac
aatgacttatctcaggaagagttgaatgctataaatgaaaaggcggtgccagtaacaatg
gaggaggaactgaagtttgtcaatttttttgccaaaaaagtacaatccttttgccattca
ctaaatttaccaacggaggtatgtgctaccgcgatatccttctttagaagatttttcctt
gtaaattcaactatggaaatacatccgaaacatattcttttagccagcatatttttggca
tgcaaatcagagaactattttataggtattgaagcctttgccaaaaaaactaagtctcaa
cccacaactattcttaagtacgagttcgatgtgctagaatcgttacagtttactttgtta
aatcaccatccatacaggccgttgcatgggtttttcttggatatccagtacattttacat
ggaaaagtcgatttaaattatatgggccagatctacacaaattgcaagagaagaataacc
gaaactcttctcacagatgtagtatatcattacaccccaccgcaaattacacttgcatgc
ttgttgatagatgatgaagcgttaacgctaaaatacttggaagtgaagtttgggagccct
cctgaggagcaaaaggactcggaaacggaaggcttgaaaacggaagaaacaccatcagat
accaaattaccatctaatttaaaattgcaaactttaacagcgctaatacgagagtgtcag
gcgatgattttgaacgttgaaacactttccaaagaagaggcaactaaaattgacgcaaaa
ttgcattactgccaaaatccaatgctgctggtagataggatgcgcagacaaaagcaacaa
cgtgatagctccgctgagcttacaacggaaccggattctaaaaagttgaaagtgtag

DBGET integrated database retrieval system