KEGG   Kluyveromyces lactis: KLLA0E07371gHelp
Entry
KLLA0E07371g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
kla  Kluyveromyces lactis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KLLA0E07371g
   03420 Nucleotide excision repair
    KLLA0E07371g
   03430 Mismatch repair
    KLLA0E07371g
   03440 Homologous recombination
    KLLA0E07371g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(667907..668590)
Genome map
AA seq 227 aa AA seqDB search
MQSAKQQIQDGPYVIMGQELHHVSFVGVIRNVADNTSNVTLTVEDGTGQIEFRKWTNDSN
DMSHASQEDQNGDYNSQVAQDYSVGKYIKVYASLREFSGKMNVQYAVVKHIDSFNEILAH
HLEVIKAFAVANGNLSVDSTVAVNGANTETNSLFVQDNEPPKSATEKVLDFIRAQCAGKD
SNSFSVQTKLISQSLNMIEDDVRMYCQTLTEQGYIYPTFDEFTFFIL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgcaaagcaacaaattcaagatggaccatacgttataatgggtcaagaactt
caccatgtgtcatttgttggtgtcattagaaacgttgctgataatacatcgaatgttact
cttacagttgaagatgggactgggcaaatcgaattccgaaaatggactaatgatagcaat
gatatgtcgcacgcctctcaagaggaccaaaatggtgattataactcgcaagtagcacaa
gactactcggtagggaaatacatcaaggtatacgcttctctaagagaattcagtggtaag
atgaatgtacaatacgctgtagtaaagcatattgattcattcaatgaaattctagcacat
cacctggaggtaattaaggcatttgctgtggctaacggtaacttgagtgttgactcaacg
gtggcagttaacggagctaatactgaaaccaatagtttatttgtacaagataacgagcct
ccaaaatcagccactgaaaaagttttggattttatcagagcccagtgcgctggcaaggat
tcaaactctttctctgtgcagactaaacttatctctcaatctttgaacatgattgaagat
gatgtcagaatgtattgtcaaactctaacagaacaaggttacatataccctaccttcgac
gagttcaccttctttatcttataa

DBGET integrated database retrieval system