KEGG   Kluyveromyces lactis: KLLA0E08141gHelp
Entry
KLLA0E08141g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
kla  Kluyveromyces lactis
Pathway
kla00600  Sphingolipid metabolism
kla01100  Metabolic pathways
Module
kla_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KLLA0E08141g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     KLLA0E08141g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 2894267
NCBI-ProteinID: XP_454318
UniProt: Q6CP21
Position
E:complement(736008..737117)
Genome map
AA seq 369 aa AA seqDB search
MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYSVLLSSIL
LSLLFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV
LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD
QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN
VILILMDIVDVLLSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN
LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR
SDEEDENSD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgaattgaggcaaagacattcttctgggagtgcagctccgtcattgacggag
catcgttttgatgagaaaaagcaagctcgttcacgttctaggacaggttctagttccaag
caccacttcaagccagtttccaaagtggatcgatattctgtgctgttgtcctcgattctt
ttgtcgcttttgtttgttgggaactcgttttatccggagtacactaagaagtttgttaat
ctacagtatgaatatcctgataatcctgggaagtatgatattggaatagacgatggctac
gttatcttaactttcattgttgtgttctgtttggtgagatcgttcttgttggagtttgtt
ttgaaaccagtgggtagaaatagatttcacatgagatctgtaaaatctcttcaaagattc
ggagagcaagggtggtccatgatttactatttgttttcatggatatttggattctatctg
tattatcattctccatattacttcaacatcgatcatatttatagcggctggccccatgac
caattatcaggtttgttcaagacctattatttgttccaaattgcatcttggttccatcaa
atcattgtcttaaatgtggaagaaagacgtaaggatttttggcaaatgttcgctcatcat
attattactgtagcattgactactggttcatattattattatttcacaagaatcgggaat
gtcattttaatcttaatggatatagtggatgtgctgttgtcctttgctaagatgctgaaa
tactgcggatacagtactttatgtgattatatgtttgttgtatttctattttggtgggtt
atgttaagacacgttgtttacaattatctcacttaccagacttggctaagagctaaaaat
ttaatggcagatggcgagtgtattgcaggtttagcacagaaaagatgttggacgccgact
gtcgttaacattttccttgcattgctcggtggtctacaagtcatcacttgcatttggatg
tatcttatcctgaaagttcttgtgaaagttatcaaaggtataggtgccgaagatgttaga
agtgatgaggaagacgaaaacagtgattga

DBGET integrated database retrieval system