KEGG   Kluyveromyces lactis: KLLA0E08801gHelp
Entry
KLLA0E08801g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLLA0E08801g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0E08801g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:784991..787306
Genome map
AA seq 771 aa AA seqDB search
MLTTILEKLGFEEKRVLKAVLIGLIASLYFLYKNEFDITRVAVSVVSTTKEITQAVRDKI
MLGRWAPRNAEQEETIVRRGGYVGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSN
DDSQNTIDENGEESDLPNEQSTVEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMH
FTLALQDLFSKLNAKHYRNRPWFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTILSEL
EKNVESIYGKPEKDPKPVPQDDLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLASGRKFY
SPYKIVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDNIGSPIKLSQLLDEWSK
PEIIEGVDCNRCALNAVLEHLVEQLNTIQSQPDVNQKLVTLMEDRINEVKSVLSKLAIDD
DDYKRMHTENMVRKSSKSKQILISRPPPLLSVHINRSVFDPRTYMIRKNNSRVIFKSKLN
LSPWCCNYDKINLDARLPMSKKQENWHESSEDDNNGTEYYNKLHRRFEKEFEDSDEEEDG
SDNGQGMFNGSSRMVEEHDVLNGELSSASLSSSEDDIAEVEEVELDALGNTIVKKTAKKP
LLGGNQDVSISRGNLDIVDAEGNSEQEDDPEDDDEDEAYEEDEAEEDEENSEEESDDSLP
TPPLPPTQPIVSSVPAGPLTYVLRSVIVHYGTHNYGHYIAFRRFRGCWWRISDESVYIVD
EQEVLSTPGVFMLFYEYDYDTETGKMKDDTEYENEFNVEIEGEPAVDQVTH
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccacgattttagagaagttaggctttgaagaaaagagagttttaaaagcggta
ctaattggattaattgcttcgctatacttcctgtacaagaacgaatttgatatcacaaga
gtggctgtttctgttgtaagtaccacgaaagaaattacacaagcagtaagggataaaata
atgcttggtcgatgggctccaagaaatgcggagcaagaggagactattgtcagaagaggt
ggttatgttggaggtttagtgaatgacggtaacacatgctttatgaattcagtgctccaa
tgtttggcctcgtccaaagagttgcataaattcatggacactattatcctagattctaat
gatgacagtcaaaatacaattgatgagaatggagaagaatcagatttgcctaatgagcaa
tctactgttgagaagaagcctaaagcaacaaagaataagacatatggaaagaggaaaaag
atcgctgtacgtcaagcagacaacgagctcttaaaaaactcaacagaacctaatatgcat
ttcacattggctcttcaggatctattctcaaagttgaatgcgaaacattaccgtaacaga
ccatggtttaagaccaacaaacttttgaaaactatgtcaaaagctccaaataggaacatc
atcctaggttatgatcaagaagatgctcaagagtttttccaaactatcctttcagagctg
gagaagaatgttgaaagcatatatggaaaaccagaaaaggatccaaagccagtaccacaa
gatgatttgcctgaagatgcaattgttggacaagaacacctcggcgagattggtgatgtc
tatatcccaacggaacagatcgacccaaactccgtgcttgcatctggtaggaaattctat
tctccatataaaattgttactcccttagatggtatcactgccgaaagaattggatgtttg
caatgtggtgagaatggtgggataagatattcagtcttctcaggtctatctttgaattta
cccagtgataacatcggttccccaatcaaactgtcacaacttcttgacgagtggtcgaaa
cctgagatcatcgaaggagttgactgtaatcgttgtgcattgaacgctgttttggaacat
ttagtagaacaactgaacaccatccaatcacagccagatgtcaatcaaaaactagtaacc
ttgatggaggataggatcaatgaagttaaatcagtgttgtcaaagcttgccatcgatgat
gatgactataagaggatgcatactgagaacatggttcgcaaatcctcaaagtcaaaacaa
attttgatttctagacctccaccattgttatctgttcacatcaaccggtccgtttttgac
cctcgcacttatatgatcaggaaaaataactcaagagttatattcaaaagcaaattgaat
ctatcaccttggtgttgcaattatgataagattaatcttgatgcacgtcttccgatgtcc
aagaagcaagagaactggcacgaatcatccgaagatgacaataatggaactgaatactac
aataagttgcatcgcagatttgaaaaagaatttgaagacagcgatgaagaggaggatgga
agtgataatggtcaaggaatgttcaatggatcttcaagaatggtggaagagcatgatgtt
ttgaatggtgaattaagttcggcatcgttgtcatcatccgaagacgatattgctgaagtc
gaagaggtggagttagatgcccttggaaatacaatcgtaaaaaagactgccaaaaaacca
ttattaggtggcaatcaagatgtgtctatctccagaggaaacctcgatatagtagatgcc
gaaggcaactctgagcaagaagatgatcctgaagatgatgatgaggatgaagcttatgaa
gaagacgaagctgaagaagacgaggaaaactccgaagaagaatcagatgactccttgcca
acacctccgcttcctcctacacaaccaattgtgtccagcgttcctgccgggcctttgaca
tatgttttaagatctgttattgtacattatggtactcataactatggtcattacattgca
tttagaaggttccgtggttgctggtggagaattagtgacgaaagtgtttacattgtcgac
gaacaagaagtgctttctacccccggtgttttcatgttgttctacgagtacgattatgat
acagaaacagggaagatgaaagacgatactgaatacgagaatgaattcaacgtagagatt
gaaggtgaacctgctgttgatcaagtaactcattga

DBGET integrated database retrieval system