KEGG   Kluyveromyces lactis: KLLA0E09791gHelp
Entry
KLLA0E09791g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kla  Kluyveromyces lactis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLLA0E09791g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0E09791g
   00020 Citrate cycle (TCA cycle)
    KLLA0E09791g
   00620 Pyruvate metabolism
    KLLA0E09791g
Enzymes [BR:kla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KLLA0E09791g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:865604..866821
Genome map
AA seq 405 aa AA seqDB search
MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE
VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE
SKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTAD
ALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETAAA
AAAAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASE
LYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEAS
AVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFVAQLSNLELFQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtttagcaattaaaaacagggcgtgtctccgtcaattacaccaatgtagaact
atgttgaaggcccaagcctttgggatgcctgccatgtcaccaaccatggaaaggggcggt
gtcgttgattggaagttcaaagctggtgatactttctctgccggtgatgtgctcttggag
gttgaaaccgacaaggcaaccattgacgtggaggcacaagatgacggtaagcttgccaaa
attttgaaggagaacggtgccaaggatattcctgtcggggaacccattgcatacatcgct
gatgtggacgatgatttggccactttggagttcccaaagcccgttgaagccaagaaagaa
tcaaagccagttgaaactaaaaaggaggaggccaaaccagtggaaaaaactgacaagaag
aagcaaaccagtgcttcaaaaacaccttctaagaacggcagtgttcaggctaatgcatct
caaacattattcccatctgtgctatcactactagaggaaaacaatatttcaactgcagat
gcgttggacaaaatcaaggccactggtccaaacggtagaatcttaaaaggtgatgtgcta
gcctatttgggtaagatttcccaagattcgttgaacaaggtaaccgagtacatcaaatcc
catgagaaattggatctaaccaacatcgaattaagacctgctagagaaactgcagcagca
gcagcagcagcacaagctgctaaacccgctaaaccattacctctagtactaagcgaacag
atcacactccatgtcccagaaaacgtcacttactcccaactatctgctgcgatagcatcg
tacgtcaaggaatgttcattcttggcacacgacgaaccattgaccaatgacgcatccgaa
ctatacgacccattattcgaagagttactagtacaagaaccaacaaaacctcgtttcaag
gtcacttataacatagtagacttggaacctacaccaagacaccgtacctcttcaccacaa
ccagatatctttgatttattatctggtacaacaacgcaagaactacaacaagaggcatcc
gcagtatccaaacaacaacaaacacgtcacgaatacgcgttgaacgtttccgtcgccgtt
gacgaatcgttaacggatgccaagcaaagagcagaaaatttcgttgcccaactatctaac
ttggaattgttccaatga

DBGET integrated database retrieval system