KEGG   Kluyveromyces lactis: KLLA0E10011gHelp
Entry
KLLA0E10011g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLLA0E10011g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   KLLA0E10011g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(887535..888464)
Genome map
AA seq 309 aa AA seqDB search
MSGWNTIESDAGVFTRLITDLGVEGLQFEDIPYLQYLEEESVSSLLKGVVFLFPYEVSLY
QGSEPVQGTYETDSDKLFFSQQTIQNACATQAVINILFNLAKEDEESVTLGPELSQFYEF
VKDFHQAELIGETINNSELIRNVHNSFTPPNLFVMDEDPYRNRGKPEEVFHFVGFIPYRS
RIYELDGLRPYPIDHGPFTDFAKDVQNILQERMNILVQLGVHKFNIIGVIKDKLEFLQNQ
LQKEDINDSEEFILAEQLQEELNKREKWNEEITFRRHNLTGLVLELAKQTCSSMSQQEFQ
DALVHASDK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggctggaacactattgaatcggacgctggagtattcacacgattaattacggat
ctaggcgttgaaggattgcaatttgaagatataccttatttgcaatatctcgaagaagaa
tcagtatcttctttacttaaaggtgtggtgtttttatttccttatgaggtttccttgtat
cagggttcagagcccgtccagggtacatatgaaacagacagtgataaacttttcttctcc
cagcaaactattcagaatgcttgtgcgacgcaagctgtaataaacatattgtttaattta
gccaaggaagatgaagaatcagttacattgggtccagaattgtcccaattctatgaattt
gtgaaggatttccatcaagcagaattgattggtgaaacaatcaataattcagaattgatt
cgaaatgtgcataattcttttacaccacctaacctttttgtcatggatgaagatccttac
aggaacagaggaaaaccagaagaagtcttccattttgtcgggtttatcccatacagatca
agaatttatgaattagatggtttaaggccataccctattgatcatggtccattcactgac
tttgccaaagatgtgcaaaacatcttgcaggaaagaatgaacattttagttcaattagga
gtgcataagttcaacataattggtgtaataaaggacaaactagagttcttacaaaatcaa
ctacagaaggaagacattaatgatagcgaagagtttatacttgcggagcagttgcaagag
gaactgaataaaagagaaaaatggaacgaagagataacattccgcagacacaatctcact
ggtcttgtcttagaattagcgaaacagacatgctcttctatgtcgcaacaggagtttcaa
gatgccttagtgcatgcgtcagataaatag

DBGET integrated database retrieval system