KEGG   Kluyveromyces lactis: KLLA0E10275gHelp
Entry
KLLA0E10275g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
kla  Kluyveromyces lactis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:kla04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:906675..909065
Genome map
AA seq 796 aa AA seqDB search
MLEHNSKLFCKSLSQLSAVASKVVAEDVEGEHFKQLLAKCIDTLSIYKSELRKLSCASKD
TPPSQIYQLNETLYVYYKIVSQIASQVIPGLAEFQQIKMNSKKDSKDKELLEIYSRLVSA
LANDKQIGEVKRFIKNHSEEAAHDGTQHSYENGEFVSISQLHSLIRHDNDSSGILLVDIR
PRMDFNDGHIKHNNVICIEPISFKESYTDSDILRKSLITASDREVDLFKNRDKFRLIVLY
TDTDEHTKYYWQQLEVLQDILCNRSFDKPLHHTKVIVLQNGVNAWKEKYPMELKKIMESA
ISDIRTKPVEHNFHPMALSNNNNIEKANSPSHSQTTSFTHYPDAPFLTNGASIKTAGLVP
NQLLPSTSNLTKALQQNDEGNSEPYKLQPNGIKNHRQESNNHANGTNCIVSSNGNNSVAK
SGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGL
LANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFKGKQQQDCQEFCQ
FLLDGLHEDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTDFSVIVDLFQG
QYASQLRCKICAHTSTTYQAFSVLSVPVPRARSCTIYDCFKEFTKLETLEKDELWYCPYC
KQRQPSTKQIIITRLPNNLIIHLKRFDNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKD
NGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDE
YITPNAYVLFYRRVNM
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaacataactccaagttgttttgtaaatcactttcgcagctttcagctgtagcg
tcgaaggttgtggctgaggatgttgaaggtgaacatttcaagcagctcttggcgaaatgt
atagacacgttgtcaatatacaagagcgagctgcgaaaactttcatgtgcttccaaggac
acaccaccatcgcagatatatcagttgaatgagacattgtacgtttactataagattgtg
tcacagatcgcatctcaggttattccggggttggccgagtttcaacagatcaagatgaat
agtaagaaggattcaaaagataaagaattgctggaaatttatagtagattggtttctgca
ctagcgaatgataaacagataggggaagtgaagaggtttatcaaaaatcacagtgaggaa
gctgctcatgacggtactcaacactcttatgagaatggggaatttgtgtcaatttcgcag
ttgcattcactaatacggcatgataacgactcatctggcattttactcgttgatattaga
ccaaggatggattttaacgatggtcatataaagcataacaacgttatttgcatcgaaccg
atctcgttcaaagaatcatacacggattctgatatcttgcgtaagtcattaatcactgca
tcggatagagaagttgatcttttcaagaatcgtgataagtttcgacttattgtgctttac
acagacactgatgagcatacgaaatattactggcaacagttagaagttttacaagacatt
ctttgcaatagatcatttgataaacctttacatcatactaaggtaatagttttgcaaaat
ggcgtaaacgcttggaaggagaagtaccccatggagttgaaaaaaataatggaatcggca
atatctgatattcgtacgaagcccgtggaacacaattttcaccctatggcattatcaaac
aataataatattgaaaaagccaattcaccgagtcactctcaaactacaagtttcacacat
tatcctgatgctccattccttactaatggagctagtattaaaactgctggattggtgcct
aatcagttgttgccatctaccagtaatttaacgaaagcgttacagcagaacgatgaagga
aattctgaaccttacaaacttcaaccaaatggaatcaaaaaccacagacaggaaagtaat
aatcatgcgaacggtacaaattgcattgtgagttcaaacgggaataactctgttgctaaa
tctggtcatcctagtatcaatctggatttcgcgattggtttagtgaatttaggaaattca
tgctatttgaactgcataattcaatgtcttctcggttgtcatgagctatcatacatattt
ctgaccaattcatataggaaacatgtcaatgtgaacagtcgattaggttccaagggttta
ttagcgaattatttttcacaactagtacagaagatgtatcaacaggggaaactacaggct
tataacaatactaatatggagtcaacggctgtgcatccaactcaattcaaattggcgtgt
ggctcgataaattcactgtttaaaggcaagcagcagcaggactgtcaagaattttgccaa
tttctcttagatggtttacatgaagatttgaaccaatgtggtaccaatcctcctcttaag
gaattaagtccagaagctgagaaaatgagagaaaccatgccgatgagaattgcttcagcc
atcgaatgggagagatatttgacgacagatttcagtgtcatcgtggatttgttccaaggc
caatatgcatcgcagctcagatgtaaaatttgtgcacatacgtccacaacttatcaagca
ttctctgttctttcagtaccagttcccagagcaagatcttgcacaatttacgactgtttc
aaagagtttaccaagctagaaactttggaaaaagacgaattgtggtattgtccttattgt
aaacagagacaaccatcaaccaaacaaatcatcatcacacgtttgcctaataatttaatc
attcacttaaaaagatttgataatatgatgaataaaaacaacgtttttgtcaattatcca
aatgaactagacttaactggcttttggatcgacgattacaatggagaaatgccaaaggat
aacggggtttcgttgccattgcgtggtcaaaagccacccttcaactatagactctttgct
gtggcgtcacattctggcacgctctatggtggccattacacctcctttgtggacaaaggc
agagttggttggtgttcttttgatgatgtcagttggagaaaaattagaaggaaggacgaa
tatatcacacctaatgcatatgtgctgttttaccgtagagttaacatgtaa

DBGET integrated database retrieval system