KEGG   Kluyveromyces lactis: KLLA0E10275gHelp
Entry
KLLA0E10275g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
kla  Kluyveromyces lactis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:kla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    KLLA0E10275g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLLA0E10275g
Peptidases [BR:kla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLLA0E10275g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:906675..909065
Genome map
AA seq 796 aa AA seqDB search
MLEHNSKLFCKSLSQLSAVASKVVAEDVEGEHFKQLLAKCIDTLSIYKSELRKLSCASKD
TPPSQIYQLNETLYVYYKIVSQIASQVIPGLAEFQQIKMNSKKDSKDKELLEIYSRLVSA
LANDKQIGEVKRFIKNHSEEAAHDGTQHSYENGEFVSISQLHSLIRHDNDSSGILLVDIR
PRMDFNDGHIKHNNVICIEPISFKESYTDSDILRKSLITASDREVDLFKNRDKFRLIVLY
TDTDEHTKYYWQQLEVLQDILCNRSFDKPLHHTKVIVLQNGVNAWKEKYPMELKKIMESA
ISDIRTKPVEHNFHPMALSNNNNIEKANSPSHSQTTSFTHYPDAPFLTNGASIKTAGLVP
NQLLPSTSNLTKALQQNDEGNSEPYKLQPNGIKNHRQESNNHANGTNCIVSSNGNNSVAK
SGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGL
LANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFKGKQQQDCQEFCQ
FLLDGLHEDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTDFSVIVDLFQG
QYASQLRCKICAHTSTTYQAFSVLSVPVPRARSCTIYDCFKEFTKLETLEKDELWYCPYC
KQRQPSTKQIIITRLPNNLIIHLKRFDNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKD
NGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDE
YITPNAYVLFYRRVNM
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaacataactccaagttgttttgtaaatcactttcgcagctttcagctgtagcg
tcgaaggttgtggctgaggatgttgaaggtgaacatttcaagcagctcttggcgaaatgt
atagacacgttgtcaatatacaagagcgagctgcgaaaactttcatgtgcttccaaggac
acaccaccatcgcagatatatcagttgaatgagacattgtacgtttactataagattgtg
tcacagatcgcatctcaggttattccggggttggccgagtttcaacagatcaagatgaat
agtaagaaggattcaaaagataaagaattgctggaaatttatagtagattggtttctgca
ctagcgaatgataaacagataggggaagtgaagaggtttatcaaaaatcacagtgaggaa
gctgctcatgacggtactcaacactcttatgagaatggggaatttgtgtcaatttcgcag
ttgcattcactaatacggcatgataacgactcatctggcattttactcgttgatattaga
ccaaggatggattttaacgatggtcatataaagcataacaacgttatttgcatcgaaccg
atctcgttcaaagaatcatacacggattctgatatcttgcgtaagtcattaatcactgca
tcggatagagaagttgatcttttcaagaatcgtgataagtttcgacttattgtgctttac
acagacactgatgagcatacgaaatattactggcaacagttagaagttttacaagacatt
ctttgcaatagatcatttgataaacctttacatcatactaaggtaatagttttgcaaaat
ggcgtaaacgcttggaaggagaagtaccccatggagttgaaaaaaataatggaatcggca
atatctgatattcgtacgaagcccgtggaacacaattttcaccctatggcattatcaaac
aataataatattgaaaaagccaattcaccgagtcactctcaaactacaagtttcacacat
tatcctgatgctccattccttactaatggagctagtattaaaactgctggattggtgcct
aatcagttgttgccatctaccagtaatttaacgaaagcgttacagcagaacgatgaagga
aattctgaaccttacaaacttcaaccaaatggaatcaaaaaccacagacaggaaagtaat
aatcatgcgaacggtacaaattgcattgtgagttcaaacgggaataactctgttgctaaa
tctggtcatcctagtatcaatctggatttcgcgattggtttagtgaatttaggaaattca
tgctatttgaactgcataattcaatgtcttctcggttgtcatgagctatcatacatattt
ctgaccaattcatataggaaacatgtcaatgtgaacagtcgattaggttccaagggttta
ttagcgaattatttttcacaactagtacagaagatgtatcaacaggggaaactacaggct
tataacaatactaatatggagtcaacggctgtgcatccaactcaattcaaattggcgtgt
ggctcgataaattcactgtttaaaggcaagcagcagcaggactgtcaagaattttgccaa
tttctcttagatggtttacatgaagatttgaaccaatgtggtaccaatcctcctcttaag
gaattaagtccagaagctgagaaaatgagagaaaccatgccgatgagaattgcttcagcc
atcgaatgggagagatatttgacgacagatttcagtgtcatcgtggatttgttccaaggc
caatatgcatcgcagctcagatgtaaaatttgtgcacatacgtccacaacttatcaagca
ttctctgttctttcagtaccagttcccagagcaagatcttgcacaatttacgactgtttc
aaagagtttaccaagctagaaactttggaaaaagacgaattgtggtattgtccttattgt
aaacagagacaaccatcaaccaaacaaatcatcatcacacgtttgcctaataatttaatc
attcacttaaaaagatttgataatatgatgaataaaaacaacgtttttgtcaattatcca
aatgaactagacttaactggcttttggatcgacgattacaatggagaaatgccaaaggat
aacggggtttcgttgccattgcgtggtcaaaagccacccttcaactatagactctttgct
gtggcgtcacattctggcacgctctatggtggccattacacctcctttgtggacaaaggc
agagttggttggtgttcttttgatgatgtcagttggagaaaaattagaaggaaggacgaa
tatatcacacctaatgcatatgtgctgttttaccgtagagttaacatgtaa

DBGET integrated database retrieval system