KEGG   Kluyveromyces lactis: KLLA0E10539gHelp
Entry
KLLA0E10539g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
kla  Kluyveromyces lactis
Brite
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLLA0E10539g
Protein kinases [BR:kla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   KLLA0E10539g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KLLA0E10539g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:929989..931104
Genome map
AA seq 371 aa AA seqDB search
MGKRIVFNISSEFQLQSLLGEGAYGVVCSAKHKPSGEIVAIKKIEPFEKPLFSIRTLREI
KILKHFQHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHRVIVTQELSEDHVQYFVYQ
TLRALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDD
NSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPL
FPGKDYRDQLILIFQTLGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAA
LDLLDRMLQFDPRLRITATEALSHPYLVSYHDPDDEPEGTPIPSSFFQFDQWKSRLNTKD
LKRLLWNEIVS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggatagtatttaacataagctctgagtttcaactacagtcgcttctcggt
gagggtgcttacggagtggtatgttcagcgaagcacaaacccagtggagaaatagttgct
atcaaaaagatcgaaccttttgagaaacccctattttctattagaacattaagagagatc
aagatattgaagcatttccaacacgaaaacataatcagcatatttgacgtgcaaaaacca
tcatctttcgaacagtttaacgaggtgtacataattcaagagttgatgcagacggacttg
catagagtgatcgtgacgcaggaactaagtgaggatcatgtgcagtattttgtataccaa
actttaagggcgcttaaagtgctgcatggaagtaatgtgatccatcgagatttaaaacca
agtaatttgttgttaaacagcaactgcgatttgaaaatctgtgattttggtttggcaaga
attgtatctgaaagagcaacagatggcgatgcccatgttgacgctgatgacacggatgat
aactccccttcatcggcggctaatgacggtgacccggcaatttcgggaatgacagagtat
gtggcaacccgatggtaccgagcaccggaagtaatgttaacagctgcacagtactccaag
tccatggacgtatggtcatgcggatgcattcttgccgagctcttggggaaacaaccgttg
ttccccgggaaagattacagagatcagttgatcctgatatttcagactttagggacaccc
acggaacaagaattggtggagctagtagaaaatagacgtgcacgtgagtacattcgctcg
ttacctaagcatcccaagatcaattggcggcgtaggttcccgaatgcatctgcagccgct
cttgatctccttgaccggatgctgcaattcgatccgaggctacggatcactgccacggaa
gcgctatcacatccatacttggtctcgtaccatgacccggacgacgagcccgaaggaact
ccgattccttcgtcattctttcaatttgaccaatggaagtcgcggctaaatacaaaggat
ttgaagcggctgttatggaacgaaatcgtgtcatga

DBGET integrated database retrieval system