KEGG   Kluyveromyces lactis: KLLA0E10649gHelp
Entry
KLLA0E10649g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
kla  Kluyveromyces lactis
Pathway
kla00260  Glycine, serine and threonine metabolism
kla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01230  Biosynthesis of amino acids
Module
kla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLLA0E10649g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KLLA0E10649g
Enzymes [BR:kla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KLLA0E10649g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 2894014
NCBI-ProteinID: XP_454431
UniProt: Q6CNQ8
Position
E:938243..940372
Genome map
AA seq 709 aa AA seqDB search
MSVLLRQAFENAKKEGRNALVTFMTAGYPTLEDTIQIMKGFQDGGVDVIELGLPFSDPVA
DGPVIQIANTVALKNGIDMPKVLALVKQAREEGITVPIVLMGYYNPILNYGEEKFIKDAG
AAGVNGFLIVDLPPEEALKVRNYVGENGLSLIPLVAPSTTDERLSLLSHLADSFIYVVSR
MGTTGARESVANDLSALVQKVRSFSGDIPLAVGFGISTKEHFDVVGSVSDGVVIGSKIVT
LIGEAAQDKRYETAKNYAEEISGGKKGKVLSKEEFWNIHKANVATAKENKTVAKEFEEFH
KFPARFGEFGGQYVPEALHACLRQLERGFEDAVADPAFWEEFKSLYSYIGRPSSFHKADR
LTEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKVIAETGAGQHGVATATAC
AKFGLECTVFMGAEDTRRQALNVFRMRILGAKVVPVTNGTQTLRDATSEAFRYWVSNLES
THYIVGSAIGPHPYPTLVRTFQSVIGNETKQQFAALNDGKLPDAIVACVGGGSNSTGMFS
PFEHDASVRLIGVEAGGDGIDTDHHSATLTVGRPGVLHGVKTYVLQDSDGQVHDTHSVSA
GLDYPGVGPELAAWKASGRADFMAATDAEALEGFRLLSQLEGIIPALESSHAVYGAVQIA
KTMKKDQHLIINISGRGDKDVQSVAEILPRLGPQIGWDLRFEKDPTAGN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgttgttgagacaagcgtttgaaaacgctaagaaagaaggccgcaatgccctt
gtcacttttatgactgctggatatccaaccctagaggataccattcaaatcatgaagggt
ttccaagacggtggtgttgatgttattgagttaggcttaccattttctgatccagttgct
gatggtccagtgattcaaattgccaatactgttgcattgaagaacggtatcgatatgcca
aaagttttggctctagttaagcaagcaagagaagaaggtatcaccgtaccaattgtattg
atgggttactataatcctatcttaaactacggtgaagagaaattcattaaggatgctggt
gctgctggtgtcaatggtttccttatcgttgatttaccaccagaagaagctttgaaagtt
agaaactacgtcggtgaaaacggattgagtttaatcccattagtggctccttctacaaca
gatgaaagattgagtctactgtcccatctcgctgattcattcatctatgttgtctccagg
atgggtaccactggtgccagagaatcagtcgctaacgatttaagtgctcttgtccaaaaa
gttagatcattctctggtgatattccattggctgttgggttcggtatctctaccaaggag
cattttgatgtcgttggatctgtttccgatggtgttgtcattggttccaagatcgttact
ttgatcggtgaggctgctcaagataaacgttatgaaactgcaaagaattacgctgaagaa
atctctggtggtaagaaggggaaggttctttctaaagaagagttctggaacattcacaag
gccaatgttgcaactgctaaggaaaataaaacagttgccaaagagttcgaagaattccac
aagttcccggctcgtttcggagagtttggtggacaatacgttccagaagctctacatgct
tgtctaagacaattggaaagaggcttcgaagatgccgtcgctgatccagcattctgggaa
gaattcaagagtttatacagctatattggtcgtccttcctccttccacaaggctgacaga
ttgactgaatactgtggcggtgctcaaatctggttaaagagagaagatttgaaccacact
ggttcgcacaagattaacaatgccttggctcaagttttaattgccaagagactgggtaag
aaaaaggtcattgctgaaactggtgccggccaacacggtgtggcaactgctaccgcatgt
gccaagtttggtctagaatgtacagtcttcatgggtgctgaagatactcgtcgtcaagct
ttgaacgttttcagaatgagaatattaggtgctaaagtcgttcctgtcactaacggtact
caaactctaagagatgccacttctgaagctttccgttactgggtctctaatttggaatct
actcattacattgttggttctgctatcggtccacatccatacccaacgttggtcagaact
ttccaaagtgtcatcggtaatgaaacaaagcaacaatttgctgcattgaacgacggcaag
ctaccagacgccatagttgcctgtgttggtggaggttccaactccactggtatgttctct
cctttcgagcacgatgcctcggttagacttatcggtgtggaagctggtggtgacggtatt
gataccgatcatcattctgcaactttgaccgtcggtagacctggtgttctacatggtgta
aagacttacgtcttgcaagactccgatggacaagtgcatgatacccattctgtatccgct
ggtttggattacccaggtgttggtcctgaacttgctgcctggaaggcttctggtcgtgct
gacttcatggctgctactgatgctgaagctctcgaagggtttagacttttatcgcaactt
gaaggtatcattccagctctagaatcatctcacgctgtctatggtgctgttcaaatcgcc
aaaaccatgaaaaaagatcaacatttgattatcaacatctccggtagaggtgataaggat
gttcaaagcgttgctgaaattttaccaagattaggccctcaaattggctgggatctaaga
ttcgaaaaggaccctactgcaggaaactag

DBGET integrated database retrieval system