KEGG   Kluyveromyces lactis: KLLA0E10935gHelp
Entry
KLLA0E10935g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
kla  Kluyveromyces lactis
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KLLA0E10935g
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    KLLA0E10935g
Enzymes [BR:kla01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     KLLA0E10935g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(960404..961330)
Genome map
AA seq 308 aa AA seqDB search
MSTYSYLADSTYGKDNVKFLKVKKSKTDPKVHEVMECNVQVLLKGDFEVSYTEADNTPIV
PTDTVKNTILVHARKFDTWPIEKFAANLALHFTGKYAHVSGITVKIIQDRWIKYDVDNKE
SYHSFIHQGPEKKICFLDYDKKNGSSSYTLVTSIKDLTVLKSTGSMFYGYNVCEYTTLKP
TTDRILSTDIFASLTWNSAKLGSLETLEAGKKDDIFNQYYASARDITLDIFAKENSPSVQ
ATMYNMATAILKVAPEVEHVSYELPNKHYILFDLKWFKGLDNNNELFYPSPDPNGLIKCT
VGRNQAKL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctactcatacttagctgattccacctacggtaaggacaatgtcaagttttta
aaagtaaagaagtcaaagactgatccaaaagttcatgaagttatggaatgtaacgtccaa
gtgttattgaagggtgactttgaagtttcttacacagaggcagataacactcctattgtt
ccaactgacactgtcaagaacaccatcttagttcatgctagaaaatttgatacttggcct
attgaaaagtttgctgctaatttagcattgcatttcactggcaaatacgctcatgtttcg
ggtattaccgtcaagatcattcaagatcgttggataaagtatgacgttgataacaaagag
agttatcactccttcattcaccagggtccagaaaagaagatttgtttcctagactatgac
aagaagaacggcagcagcagttatactttagtgacatctattaaggatctaaccgtgttg
aaatctaccggatcaatgttctacggatacaatgtttgtgaatacaccactttgaaacca
actactgacagaatcttgtcaacagatatctttgcctcattgacctggaattcagcaaaa
cttggttctttggaaaccttggaagctggtaagaaggatgacattttcaaccaatactat
gcatctgctcgtgatataacattggacatcttcgccaaagagaactctccatccgtgcaa
gcaacaatgtacaatatggctaccgctattttgaaggtggcacctgaagttgagcacgtc
agttacgagttgccaaacaaacattacatcttgttcgatttgaaatggtttaagggcttg
gataacaacaatgaattgttctacccatctcctgatccaaacgggttgatcaagtgcacc
gttggccgtaatcaagccaagctatag

DBGET integrated database retrieval system