KEGG   Kluyveromyces lactis: KLLA0E11771gHelp
Entry
KLLA0E11771g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
kla  Kluyveromyces lactis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:kla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLLA0E11771g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1036220..1041166
Genome map
AA seq 1648 aa AA seqDB search
MWALSPFASLYESIQKADFRTDLFNEFVSDLKTLNLTDNAKKNAAKRRELESGEIKLSDG
SVYKLNQEFIIEVIKISDELDLDEIVCAEQILTAEDSSQAVDQDISLHNKGLLIYYLRRQ
YILQVVAYVLNALSSSDDVFQTLTSDGTLLNNVLQAFNTIHKELEDVKALVNKAQILDNY
DVVSKQNITFRRDFLIKEYDTLGTVLFGLSKNNLLSNATVIQKVIDHVTSLASDDFFIIF
YLPAIINTFKNLASFSSRDVESLHAQFLRDLESESIYTKPTKVVLIFIFLTFFIGWCKAE
PTTRAKQFDFAVAVDLPMTSAVELGAIEQLMVYAAETSMVEADKSMELFFDIRSLLEKHI
PRMSPKLLLDPEYSTAVSTKTYVDDPSTKYSNLSIFDYGLDSFLSTLHDFFQAFITDCAF
LLTKIKNAEEDSLLSGEDLYLDDISAKADLERFFITIYFFYASRPEYSSSFWDDKESNLY
GFIEWAAKCNDTLMKACFYLMISSLSYGSQNSHNVYHYVESNQHSSWKYIAHNINETTEK
ITQLEQKLQDLQQNGAATSEINAVAIESGLSEETIILLSSYFTLVESIAYNVDEQIKSQL
ANTFEDILFSFLKVRSPLLGAALKVLSHLIPKEETQRYGYWTKLDRLIFKSYPLDSTDSS
YIAAFNSIFTGYSEVLGFLQLFSRLVSVGTTNHSNEYMKFGKLSFPVNIGYGYRKTGVWP
YYEYILGNIFLNDEKAATKDQQTVKNVLVLDIIKSSLLSFDYSVILNSVSVGCNLDSFVQ
TSDFYSFVQQSNATATMNYLYNEKVFSKIFKIASIGIDELESELGRILKPKSLMVRDSLY
IIDIMLTHEGTYAEEFYPIVKRCSDNSVFLPKSISIRGLRFFYDAIFFNLPLTAHFGLYV
GSTNFDISLSSISILKKLATKLDSGNPRGLHKSILLTVFDSVDDSARIKQSFIDQLMSPI
TDECSLKLKVNILDFISKNLSYTDHNTTISHFLLGYQVSNTISLGPELDTFINSKTSLLQ
TIVNLMIESLSCINSLNVEYAPMRLCAEFMEIITKLCRNPLTCKITLDYLSTLDLDKVLL
SMDPKVSVLSHWNGEPFNGDFDKYTSKFLNSPAIGSLLYFLKYRSLLMQFLSLSVHTFSY
AANNSKCDDLMKALVSNAIHSATIFSFLDTLNLKSQAPSTDPFKDITILEGLDLSLDKVE
KNSSINGSLYDFSNLDSLIELKKRSETYLSITSGHPIDAQQLEVGSEKEIEIIKKTSTAF
LAYQELATFQLSGLHSWVQLVQIIVVDSKLSPIQRSNFILEVFEFIIPKVNEYVESRLPY
SEELVSLAVFLYELYHEDRVAIDNEKTLDSRLHTLFKTCINCISTPSATLRSDFYVLGTK
YLNCVLKDEILSKEVLQWLKFSNESLVETVCNDAIMGQGANRVTGILFLDALNQLASLNK
VNFVLESLVKSNMLLLIIRSIKNTDEVLETQNEKVTSYTLLYELTIFKCVVHFLTKLAQT
KAGSHALVQKKLFETITSCNFLKMDPDLGLELMFESVGAATSGKIRANLTLDNPLQITSY
ENGISLFEIIIPIFQLIASVLLSSGTSSQYVFREARKLISHFKQLVQGALKRDALLEKNG
VETKPEGLEEFVQLIILVCTLTNYSGAQ
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcactttcaccctttgcctccttgtatgaatccatacagaaagctgatttccgt
accgatttgttcaatgagtttgtatctgatttgaagacgttgaatttgactgataatgct
aagaaaaatgctgctaagagacgcgaattggaatccggagaaattaagctatccgatgga
tcagtgtacaaattgaatcaggagttcataatagaagtaatcaagatttccgatgagcta
gatcttgatgaaattgtctgtgcggaacaaatattaactgcagaggactcgtcccaagct
gtggaccaggacatatctttgcataacaagggtctactgatatactatctcagaagacaa
tatattttacaagtggtggcatacgttttgaatgcactatcctcttcagatgatgttttt
caaacacttaccagtgatgggactcttttaaacaatgttttgcaagcattcaacacaatc
cataaagaactagaggatgtgaaggcacttgtaaataaggcacaaatccttgataattat
gatgtggtttcgaaacagaatattacgttcagaagggatttcttgatcaaagaatatgac
acgttaggtactgttcttttcggtttgtccaaaaataatctactctctaatgcaacggta
atacaaaaggttattgaccatgttacatcgctagcctctgatgatttttttatcatattt
tacctacctgctataataaatactttcaaaaatttggcatccttctcctccagggatgtt
gaaagtttgcacgcccaattcctcagagatttagaatccgaatcaatatacactaaaccc
accaaggttgttctcatcttcatcttcttaacgttctttataggctggtgcaaagctgaa
ccaactacaagagcaaagcaattcgacttcgctgttgctgtagaccttccaatgacttct
gcagtcgaattgggggcaatcgaacagttgatggtatacgcagcagaaacttcgatggta
gaagcagataaaagcatggagttattctttgacatacggtccttgctagagaagcatatt
ccaagaatgtcaccaaaactcttgttagatccagagtactcaaccgcagtaagcaccaaa
acttatgttgatgacccttctaccaaatactcaaatttatcaattttcgactatggactc
gatagctttctatccactttgcatgacttctttcaagcttttattacagactgtgcattc
ctcttgacaaagataaaaaatgctgaggaagattctttattatccggtgaggatctctat
ttggatgacatctcagcgaaggcggacctagaacgatttttcattaccatatacttcttt
tatgcatctagaccggaatattcaagctctttctgggatgacaaagagtctaatctctat
ggtttcatagaatgggctgcaaaatgtaacgatactttgatgaaagcatgcttttacttg
atgatttccagtttgtcatatggatctcaaaattctcataatgtttatcattatgtggag
agtaatcagcatagttcctggaaatatattgcacataatataaacgaaacaaccgaaaaa
attacacaacttgaacagaagttacaagatctccagcaaaacggcgcagcaacaagtgag
atcaatgcggtggcaattgaaagtgggttaagtgaagaaacaattatcctgttgtcttcg
tactttaccttggttgaatctattgcatataatgttgatgaacaaataaaatcgcaatta
gctaacacattcgaagacatcctcttcagtttcctcaaagtaagaagtcctttactaggt
gcagcgctaaaagtattaagtcatttgatccctaaggaagaaactcaaaggtacggttac
tggaccaaactagaccgactcattttcaaatcatacccgttagattcaacagatagttcc
tatattgcagccttcaactcaattttcactggctactccgaagtcttaggatttttgcaa
ttgttctccagattggtgtctgtgggaacaactaatcatagtaatgagtatatgaagttt
ggtaaactaagttttcctgtgaatattggatatggatatagaaagacaggtgtatggcct
tattatgagtatattttgggtaatattttcttgaatgatgaaaaggcagctaccaaagac
cagcaaacagtcaagaacgttttggttttagatattatcaaatcttcgcttttatcattt
gactacagcgttattttgaactccgtttccgtcggttgtaatttggactcgtttgtacag
acttccgacttctattcctttgtccaacaatccaatgctactgccacaatgaactacttg
tacaacgaaaaagtgttttcaaagatcttcaaaatagcctctataggaatagatgagctg
gagagtgaacttgggcgtattttgaagccgaagtcgttgatggtcagggattcactatat
atcattgatattatgctaacacacgaaggaacatatgccgaggaattttatcctatagtg
aaacgctgctctgataactcggtgtttctacccaaaagtatcagcataagaggattgcgt
ttcttctatgacgctatcttcttcaatcttccattgacagctcacttcggtctttatgtt
ggtagcactaattttgacatttctttgagcagtattagcattttaaagaagttagcgact
aaattggactcgggaaatcctagaggtctccacaaaagtatattattgacggtattcgat
tctgttgatgattctgcaagaataaaacaaagcttcattgatcaactaatgtcgcctatt
accgatgaatgctcattgaaattaaaggtgaatattctagatttcattagcaaaaacttg
tcttacacagatcacaacaccaccatatcacattttcttttagggtatcaagtgtcgaat
actatttcattggggccagaattagatacattcataaattctaagacttcgttacttcaa
acaatcgtaaaccttatgatcgagtcactatcatgtattaacagtcttaatgttgaatat
gctccaatgaggttatgtgcagaatttatggaaataattacaaagctttgccgtaatcct
ttgacatgcaaaataactttggattatctgtcaactctggatttagataaggttcttcta
agcatggacccaaaggtgtctgtgttgtctcattggaatggagagcctttcaacggagat
tttgacaagtacacctcgaaatttttaaactcgccagctatcggatctcttctttatttt
ttgaaatatagaagtcttctaatgcaatttctaagtttgagtgtccatactttctcctat
gcggccaataattcaaaatgtgatgacctcatgaaagctcttgtttctaacgctatacat
tcagcgacaatcttttcctttttggatacgttaaacttgaaatctcaagctccttccact
gatccctttaaagacattactattttggaaggcttggatctcagcctggacaaagttgaa
aagaattcatcgataaatggatctctttatgatttttcgaacctggattccctgattgag
cttaagaaacggtctgaaacttacctctcgattacatcaggtcatccaatagatgcccaa
cagctggaagtcggctctgagaaagagatcgaaataattaagaaaacatccaccgccttc
cttgcctatcaggaattagcaacatttcaactttctggtcttcattcatgggttcaattg
gtgcagataattgttgttgacagtaaactttctccaattcaaagatccaattttatattg
gaagtatttgaattcattattcctaaagtaaacgaatatgtcgaatctcgccttccatat
tctgaggaactagtttcccttgctgtcttcctttatgaattataccatgaggatagagtt
gccatcgataatgaaaaaaccctagacagtaggttgcatacgcttttcaagacatgcata
aactgtatatcgacaccatcggcgactctaagatctgatttttatgtgcttggtacaaag
tatttgaactgtgtcctaaaggatgaaatcctttcaaaggaggtccttcaatggctgaag
ttttccaatgaatcattagtagagactgtttgcaatgatgctattatggggcaaggtgct
aatagagtaacaggaatattgtttttggatgctttaaaccaattagcaagtttgaacaaa
gtaaattttgttttggaatcacttgtcaaaagtaatatgttattattgattataagatct
atcaaaaacacagatgaggtattagagactcaaaatgagaaggtgacctcttacacatta
ttgtatgaactcacaattttcaaatgtgtggtacacttcctgacaaaattggctcaaaca
aaggctggttctcatgctttagttcaaaagaaattgtttgaaactattacgtcgtgtaac
ttcttgaaaatggatccagatcttggactagaattgatgtttgaatctgttggtgctgca
acctccggaaaaatccgtgcgaatctaactttagataaccctctccagattacatcatac
gaaaatggtatttcgctctttgaaatcattatacccatcttccagttgattgcgtcagtg
ttactcagctcaggaacatcaagccaatacgttttccgtgaggcaagaaaattgatatct
catttcaagcaattggtacaaggcgcattaaagagagatgcattacttgaaaagaatgga
gttgaaaccaaaccagaaggacttgaagaatttgttcaactcatcattttggtttgtaca
ctgacaaattattctggagcgcaataa

DBGET integrated database retrieval system