KEGG   Kluyveromyces lactis: KLLA0E12827gHelp
Entry
KLLA0E12827g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1136272..1137957
Genome map
AA seq 561 aa AA seqDB search
MITEGSNLLPSGNKPGKRYARHILFGLVLVLVVLATFSHNFTLKDQRSTLFPGFLGGHKH
PKKKNVIFFVSDGMGPASLSMTRSFQQFTDGLTFDHMLNLDEFFVGSSRTRSSNSLVTDS
AAGATAFSCGLKTYNGAIGVDPNGQPCGTLLEAAKLQGYLTGLVVTTRITDATPASFSAH
ADRRSMEQLIAQHQLGEYELGRMVDLMIGGGRTSFYPKGAAASPYGIRGSRTDGRDLIKE
AVADGWHYVGDRESFNTLSEGDNVKLPLLALLADYDIPFEIDRLDSEYPSLKEEAMTAIN
ALSKATRDSDQGFFLLVEGSRIDHAGHLNDPAAQVREVTAYDETFKAVVEYAKNSDVETV
IISTSDHETGGLVTARQVSKAYPDYLWLPEVLAKAQHSCEYLARKLIQKKLQTSETSKGN
LVKFIKHEIVEAGLGINDYTDEDIKELESLIDTPGFLMDKLTDMVSFRAQLGWTTHGHSA
VDVNIYAYSNKDGLKSKILDKLGGNHENIEIGHFMRNYLGLDLKKVTEMIKNTTHTQEFV
SSASEENYFEYIPSFLKEIEI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaaggctcaaatttgttaccatccggtaacaagccgggaaaaaggtatgcg
agacacattctttttggattggttttagttctagttgttttggccactttctcccataat
tttacattgaaagatcaaagatcaacgttgttcccagggttcttaggtggtcacaagcac
ccaaagaagaagaacgtaatatttttcgtttctgatggtatgggacctgcatctttgtcc
atgactcgttctttccagcagtttactgatgggctcacgtttgaccacatgttgaatctc
gatgaattctttgtcggttcttcaagaacaagatcttcaaattcgttagtcactgattca
gcagcgggagctactgcgttttcatgtggtttgaagacttacaacggtgccatcggtgtg
gatccaaatggacaaccttgtggtacactcttggaagccgcaaagcttcaagggtatttg
actgggttggtggtcactacaagaattactgacgcgactcctgcatcgttctctgctcat
gctgatcgtagaagcatggaacagttaattgcccaacatcagttgggtgaatatgaattg
ggtagaatggtggatttgatgatcggtggtggtagaactagcttttaccccaagggtgct
gcagcttcaccatatgggatcagaggttctcgtacagatggtcgtgacttgatcaaagaa
gctgtagcagacggttggcactatgttggagatcgcgaatcctttaataccttatccgag
ggtgataatgtgaaacttcctttgcttgctttgttagctgactacgatataccctttgag
attgatagattagattcggaatatccatccttgaaagaagaagctatgactgcaatcaac
gcattgtccaaagcaactagggattcagaccagggatttttcttgttagttgaaggttct
cgtattgaccatgcaggtcatttgaacgatcctgctgcacaggttcgtgaggtcactgca
tatgatgagacgttcaaggctgttgttgaatacgctaaaaattcagacgtagaaaccgtc
ataatttcaacttcagatcatgaaacaggtggtttggtcacggccagacaagtttctaaa
gcatatccggattatttatggttacctgaagtcttggcaaaagcacaacattcgtgtgag
tacttagcaagaaagttgattcaaaaaaagcttcaaacttctgagacctcaaagggcaat
ctagttaagttcatcaaacatgaaattgtggaagctggtttaggtatcaacgattatact
gacgaagatatcaaagagcttgagagcttgatcgatacccctggctttttgatggacaaa
ttgaccgatatggtctctttcagggcgcagttgggctggacaacacatggtcatagcgca
gtcgatgttaatatatatgcatactccaacaaggacgggttgaagtctaagattttggat
aaacttggtggtaaccatgagaatattgaaattggtcatttcatgagaaattatttgggc
cttgatttgaagaaagtcacagagatgatcaaaaacaccactcatactcaggaatttgta
tcttccgcttcagaggaaaactactttgaatacattccttcattcttgaaagaaatagaa
atctaa

DBGET integrated database retrieval system