KEGG   Kluyveromyces lactis: KLLA0E12827gHelp
Entry
KLLA0E12827g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KLLA0E12827g
Enzymes [BR:kla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KLLA0E12827g
Exosome [BR:kla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLLA0E12827g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1136272..1137957
Genome map
AA seq 561 aa AA seqDB search
MITEGSNLLPSGNKPGKRYARHILFGLVLVLVVLATFSHNFTLKDQRSTLFPGFLGGHKH
PKKKNVIFFVSDGMGPASLSMTRSFQQFTDGLTFDHMLNLDEFFVGSSRTRSSNSLVTDS
AAGATAFSCGLKTYNGAIGVDPNGQPCGTLLEAAKLQGYLTGLVVTTRITDATPASFSAH
ADRRSMEQLIAQHQLGEYELGRMVDLMIGGGRTSFYPKGAAASPYGIRGSRTDGRDLIKE
AVADGWHYVGDRESFNTLSEGDNVKLPLLALLADYDIPFEIDRLDSEYPSLKEEAMTAIN
ALSKATRDSDQGFFLLVEGSRIDHAGHLNDPAAQVREVTAYDETFKAVVEYAKNSDVETV
IISTSDHETGGLVTARQVSKAYPDYLWLPEVLAKAQHSCEYLARKLIQKKLQTSETSKGN
LVKFIKHEIVEAGLGINDYTDEDIKELESLIDTPGFLMDKLTDMVSFRAQLGWTTHGHSA
VDVNIYAYSNKDGLKSKILDKLGGNHENIEIGHFMRNYLGLDLKKVTEMIKNTTHTQEFV
SSASEENYFEYIPSFLKEIEI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaaggctcaaatttgttaccatccggtaacaagccgggaaaaaggtatgcg
agacacattctttttggattggttttagttctagttgttttggccactttctcccataat
tttacattgaaagatcaaagatcaacgttgttcccagggttcttaggtggtcacaagcac
ccaaagaagaagaacgtaatatttttcgtttctgatggtatgggacctgcatctttgtcc
atgactcgttctttccagcagtttactgatgggctcacgtttgaccacatgttgaatctc
gatgaattctttgtcggttcttcaagaacaagatcttcaaattcgttagtcactgattca
gcagcgggagctactgcgttttcatgtggtttgaagacttacaacggtgccatcggtgtg
gatccaaatggacaaccttgtggtacactcttggaagccgcaaagcttcaagggtatttg
actgggttggtggtcactacaagaattactgacgcgactcctgcatcgttctctgctcat
gctgatcgtagaagcatggaacagttaattgcccaacatcagttgggtgaatatgaattg
ggtagaatggtggatttgatgatcggtggtggtagaactagcttttaccccaagggtgct
gcagcttcaccatatgggatcagaggttctcgtacagatggtcgtgacttgatcaaagaa
gctgtagcagacggttggcactatgttggagatcgcgaatcctttaataccttatccgag
ggtgataatgtgaaacttcctttgcttgctttgttagctgactacgatataccctttgag
attgatagattagattcggaatatccatccttgaaagaagaagctatgactgcaatcaac
gcattgtccaaagcaactagggattcagaccagggatttttcttgttagttgaaggttct
cgtattgaccatgcaggtcatttgaacgatcctgctgcacaggttcgtgaggtcactgca
tatgatgagacgttcaaggctgttgttgaatacgctaaaaattcagacgtagaaaccgtc
ataatttcaacttcagatcatgaaacaggtggtttggtcacggccagacaagtttctaaa
gcatatccggattatttatggttacctgaagtcttggcaaaagcacaacattcgtgtgag
tacttagcaagaaagttgattcaaaaaaagcttcaaacttctgagacctcaaagggcaat
ctagttaagttcatcaaacatgaaattgtggaagctggtttaggtatcaacgattatact
gacgaagatatcaaagagcttgagagcttgatcgatacccctggctttttgatggacaaa
ttgaccgatatggtctctttcagggcgcagttgggctggacaacacatggtcatagcgca
gtcgatgttaatatatatgcatactccaacaaggacgggttgaagtctaagattttggat
aaacttggtggtaaccatgagaatattgaaattggtcatttcatgagaaattatttgggc
cttgatttgaagaaagtcacagagatgatcaaaaacaccactcatactcaggaatttgta
tcttccgcttcagaggaaaactactttgaatacattccttcattcttgaaagaaatagaa
atctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system