KEGG   Kluyveromyces lactis: KLLA0E13905gHelp
Entry
KLLA0E13905g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla00630  Glyoxylate and dicarboxylate metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01200  Carbon metabolism
Module
kla_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KLLA0E13905g
Enzymes [BR:kla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KLLA0E13905g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3982
Motif
Other DBs
NCBI-GeneID: 2893645
NCBI-ProteinID: XP_454578
UniProt: Q6CNB1
Position
E:1231826..1233544
Genome map
AA seq 572 aa AA seqDB search
MSFRCSVKFGERRGSFLMSRGLSNISRFPKPKDAEIENFVNAQAESIAKWWESDRFKNIK
RPYTPLDVVKHRGSLGDDVVYGSSIQAKRLFQVLENKFKNKLPVHTLGVIDPVQMSQLAR
CDDIEVAYVSGWACSSTMVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQMHDKKQLLQFL
ESKDTNKRVDYLKPIIADADMGHGGTTTVMKLAKLFAEKGAAGIHLEDQLHGGKRCGHLG
GAVIVPTSTHISRLVATRLQWDIMGTENLVIARTDSCNAKLLSSNVDPRDHEHIQGTINK
NVKPWSDFLSELEFDNAPSTKISMAEANWYKENKLYTFEEAAKEQLSESQFQTFKEQWNK
NLKLGKRGYLSIDELKSLVRSVNGGSDIVFNWDAPRTKEGFYMFKGGMKPAIQRSLAFAP
YADLLWLETKSPDLKQAQAFSKEIHDVYPEAKLVYNLSPSFNWSAHGFDDEQLQSFIWDL
AKEGFVLQLVSLAGLHSDASSFWKLAKRYQTEGMKAYVEEVQKVEKENGCDVLTHQQWSG
AEYVDSIMQVVQNGSSSQTLSTTGESFTETQF
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcgttgcagtgttaagttcggtgaaagaagaggatcttttcttatgagtaga
ggattgtctaatatctctaggttccccaagccaaaggacgccgaaatcgaaaattttgtt
aacgctcaagctgaaagtattgcaaaatggtgggaaagtgatcgtttcaagaatatcaag
agaccatatactccgttagatgtggtgaaacatcgcgggtctcttggagacgatgtggtc
tatggatcttctattcaggccaagcgtttatttcaagtgttagaaaataagtttaagaac
aagttaccggttcatacactaggtgttatcgatcctgttcaaatgtcacaattggctagg
tgtgatgatattgaagttgcctatgtctcaggctgggcatgttcttccactatggtggga
tcaaccaacgaagtatcccctgattttggcgattacccctatgatacagtaccaaaccaa
gtagaaagaatctttaaagctcaacagatgcatgataagaaacaattgttgcaatttttg
gaatccaaagatacgaacaaaagagtagattatttgaagccaattattgcagatgcagat
atgggccatggtggcactacgacggtgatgaaattggcaaagttgtttgctgaaaagggt
gctgccggtatacatcttgaagatcaattgcacggtggtaaaagatgtggacatttgggt
ggtgctgtcattgtaccaactagtactcatatttccagattggtagccacaagattgcaa
tgggatatcatgggtaccgaaaacttggtcattgccaggacagattcttgcaatgcgaag
ttattgagtagtaacgttgaccccagagatcatgaacacattcaaggtacaataaataag
aatgtgaaaccttggagtgatttcctttcagaattggaattcgataatgcgccatctaca
aaaatttccatggctgaagctaattggtacaaggaaaacaaactgtatacgtttgaagaa
gctgctaaggagcaactatcggagtcccagttccaaacctttaaagaacaatggaacaag
aatttgaaacttggtaagagaggatatttgtctattgatgaattgaagtcgttagtgaga
tccgttaacggtgggtcagatattgtcttcaattgggatgcaccaagaaccaaggaagga
ttttatatgttcaaaggtggcatgaagcctgccattcaaagatcgttggcatttgcacct
tatgctgacttgctatggttggaaactaagtctccagacttgaaacaggctcaggcattc
agcaaagaaatccatgatgtttaccctgaagcgaaattggtctacaatttatctccgagc
ttcaattggagtgcacatggatttgacgacgagcaactacaaagcttcatttgggatctt
gcaaaggaaggatttgtcttgcaattagtgtctctagctggattgcatagtgatgcgtcc
tcattctggaaattggccaagagataccaaaccgagggaatgaaagcttacgttgaagaa
gttcaaaaagttgaaaaagagaacggatgtgatgttctaacccaccagcaatggtcaggt
gctgaatatgtcgattctattatgcaagtagtgcaaaacggatcaagcagtcaaactttg
agtactacaggtgaaagtttcactgagactcaattctaa

DBGET integrated database retrieval system