KEGG   Kluyveromyces lactis: KLLA0E15313gHelp
Entry
KLLA0E15313g      CDS       T01025                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
kla  Kluyveromyces lactis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:kla04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1362851..1365025
Genome map
AA seq 724 aa AA seqDB search
MSNSLRRSSASSSSSQGKPGRNGSGNGSYSQINSSLHARVKAFQEQRQLKRSGSIHSNQS
QNSVQIEQIVNKPLPPLPPKTMVEEAENSQQLEQQQQQQHNIQIQQTQQQQQRQPILKQQ
DQHLQHLQHTELLAQSVTENDQHDQQQQQQGGLLLSPKTELPDIEEKKGQFEKQTQEALA
NLSIQSDGMSSASESSGSASNKQQQDHELNPIRKAPKRPQGVPSCTGSGNAGAPSPIGGV
GGSQAAAGTFRPPAAAGGVVMPNQPRLSQGQPHLQKAKQSLSARRGLKLPTGGMSLKMKP
THQQQQLAPQHTHQEFAGAPSNSALPLQGKRSNPGSLINGIQSTSTSLANSSHDTLGTDP
KSNPTSNSNSGIGGLFANFSKYVNIKSGSLNFAGKLSLSSKGVDFSNGSSFRIKLDELEF
LEELGHGNYGNVSKVLHKPTHIIMAMKEVRLELDESKFRQILMELEVLHNCQSPYIVDFY
GAFFIEGAVYMCMEYMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHNIIH
RDVKPTNILCSASQGTIKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDKSTYSV
QSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMC
LQKIPERRPTYAALLEHPWLKKYENVDVRMSEYITNRLNKKRELLEQTGEGPPKHVPALH
MGGL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatagtttgagacggtccagtgcgtcatcttcttcgtcgcaggggaaaccagga
cgaaatggcagtgggaatggatcgtattctcaaatcaattccagtttgcatgccagagtg
aaagctttccaagaacagagacagttgaaacggtccggtagtattcattctaaccagtca
cagaattcggttcagatagagcagattgtgaataaaccgttgccgcctctgccaccgaag
acaatggttgaagaggctgagaatagccagcaattagaacaacaacaacaacaacaacat
aatatacaaatacagcaaacacaacagcaacaacaacgacaaccgatcctaaaacaacag
gaccagcatctacagcatctacagcatacggaattgttagcacaatcagttacggaaaat
gaccagcatgatcagcagcaacagcagcaggggggcctgctgctgtctcctaagacagaa
cttcccgatatagaggaaaagaagggacagtttgagaagcagacacaagaggctctggcg
aatttgagtatacagtctgacggtatgtcatctgcttcggaatcttctggtagtgccagt
aataagcaacaacaggatcatgaactcaatccgattagaaaggctccaaaacgtccgcaa
ggtgttcccagttgtactggcagcggcaatgctggtgcgccaagtccaattggtggcgtg
ggaggttctcaggcagcagcaggtactttcagaccgcctgctgctgctgggggcgttgta
atgccaaatcaaccaaggctttcacaaggtcagccacatctacaaaaggctaaacagtct
ttgtctgcaagaagaggcttgaagcttcctacgggcggcatgtccttgaagatgaaacca
acacatcaacaacagcagcttgctcctcaacatacacatcaagaatttgcgggcgctccc
tccaattctgctttgcccttgcaaggaaaacgttcgaatcccggatctttgattaatggt
attcaatccacttctacttctttggctaatagttcacatgatacacttggcactgatcct
aaatctaatcctacttctaattctaactctggtatcggtggattgtttgctaatttttcc
aagtatgtcaatattaaatcaggatctctaaatttcgcaggtaagctgtctttatcctct
aaaggtgtagactttagcaacggttccagtttccggataaagttagatgaactagagttt
ctggaagaattgggtcatggtaactatggtaacgtatccaaagttttacacaagccgact
catatcataatggccatgaaggaagtcagattggaattggacgaatcaaagtttagacag
atcttaatggaacttgaagttttgcataattgccagtcaccgtacattgtggatttctac
ggtgcatttttcattgaaggtgccgtttatatgtgtatggaatatatggatggtggatct
ctagataaaacttatgatgatgaacaaataggggggattgacgaaccacaactagcaagg
ataacaagctcagtaatacaaggattgaaggaattgaaagacgtgcataatatcatccat
cgtgatgttaaaccaactaatatcttgtgttctgcaagccagggtacaattaaactatgc
gattttggtgtgtcaggtaacctcgttgcctctttagccaagacaaatatcggttgtcaa
tcttacatggccccagaaagaatcaaatcactgaatccggacaaatcaacgtattctgtc
caatcagatatctggtctttgggtctatcgatattggaaatggcattgggagcttatccg
tatccgccagaaacgtttgacaacatattctcacagttgagtgccatcgtcgacggccca
cctcctaaacttccagagggaaagttctcagccgatgctcaaaactttgtttccatgtgt
ttgcaaaaaatccctgaacgtagacccacttatgccgctctattagaacatccatggttg
aaaaaatacgaaaacgttgacgtaagaatgagtgaatacataacgaatagattgaacaaa
aaaagggaattgctagaacaaacaggcgaaggtccacctaagcacgttcctgctttgcat
atgggcggattgtaa

DBGET integrated database retrieval system